KEGG   Naumovozyma dairenensis: NDAI_0A00450Help
Entry
NDAI_0A00450      CDS       T02234                                 

Gene name
NDAI0A00450
Definition
hypothetical protein
Orthology
K14152  
phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase / histidinol dehydrogenase [EC:3.6.1.31 3.5.4.19 1.1.1.23]
Organism
ndi  Naumovozyma dairenensis
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ndi01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:ndi00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(76940..79348)
Genome map
AA seq 802 aa AA seqDB search
MALSILPLFGADASETITSKPFLTLTGHALLDTSVLSKDQILFFIKQFNFTFQKISIQLN
DSSKFSDDDLIELLNNGITYVITSLPSSTFTSFTDSINISKERLITPTSPSYSTYKIIPA
TELSLSSFEHNLLSQLKTDRKDGLYTTLVLDTSDRCLGLVYSSIESIQKAIELQKGVYFS
RSRNNIWIKGESSGNTQLLKQIDIDCDGDALKFVVEQKNNTFCHLNTNSCFGDFNYGLLE
LQSLLQDRLQNSPEGSYTKRLFNDETLLNAKIKEEAEELTDAQTAGEIAWEAADLFYFAM
TKLVAKGVSLSDVENNLKLKHLKVTRRKGDAKEKFLPTKKEEEEEEEPKQATKIDPSAPI
HLNVVKSTNKQGVIEAVTRPIQKTSQIMHLVNPIIENVKSKGDAALIEYTAKFDGVQLTT
PVLEAPFPDEYLEGLTEEMKEALDLSIENVRKFHAAQLQKEPLVVETQPGVICSRFPRPI
ERVGLYIPGGTAVLPSTALMLGIPAQVAQCKEIVFASPPRKSDGRVSPEVVYVASQCGAS
KIVLAGGAQAVAAMAYGTESVPKVDKILGPGNQFVTAAKMYVQNDTQALCSIDMPAGPSE
VLVICDEDADEDYVASDLLSQAEHGIDSQVILCAINLSEEKIIRIQEAVNKQALALPRVD
IIRQCISHSTIILCDSYEEAFEMSNRYAPEHLILQINNANDYVELVDNAGSIFVGAYTPE
SCGDYSSGTNHTLPTYGYARQYSGANTSTFQKFITAQNVTPEGLKNIGKAVMCVAKVEGL
DGHRNAVKVRMEKLGLLPQGFE
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atggctctatctatactaccattattcggagctgatgcttctgaaacaattacatcaaaa
ccttttttaactttaacgggtcatgctttactggacacttctgtcttatcaaaagatcaa
atactattcttcatcaagcaattcaatttcactttccaaaagatctcgattcaattgaac
gattctagtaaattttctgatgacgatttaatcgaattgttgaacaatggtatcacgtac
gttattacttctttaccatcttccaccttcacttcattcacagattcaatcaacatctcc
aaagaaagattaattaccccaacttcaccatcatattctacttacaagataatcccagcc
actgaactgtcactttcttcattcgaacacaatcttttatcacaattgaaaactgaccgt
aaagatggtctctacaccaccttagttctagatacttcagatcgttgtctcggtttggtt
tattcatcaatcgaatccattcaaaaagccattgaattacaaaaaggtgtctatttctct
agatctcgtaataatatttggatcaaaggagaatcatcaggtaatacccaacttttaaaa
caaattgatatcgattgtgacggcgatgccttgaaattcgtcgtcgaacaaaaaaataac
actttttgtcacttgaatactaattcttgctttggtgatttcaattacggtcttttggaa
ttacaatccttattgcaagatagattacaaaattctccagaggggtcgtacactaagaga
ttgtttaatgatgaaactcttttgaacgctaagatcaaagaagaagctgaagaattgact
gatgcccaaactgctggtgaaattgcttgggaagctgctgatttgttctacttcgcaatg
actaaattggtagctaaaggtgtctccttgagtgacgttgagaataatttgaaattgaaa
catttgaaagttaccagaaggaaaggtgatgctaaggaaaagtttttgccaactaagaaa
gaagaagaagaagaagaagaaccaaaacaagctaccaagattgacccatctgctccaatt
catttaaatgtagtgaaaagcaccaacaaacaaggtgttattgaagctgttacaagacca
atccaaaagacttctcaaattatgcatttagtcaatccaatcattgaaaatgttaagagt
aaaggtgacgctgctttaattgaatatacagccaagttcgatggagttcaattaaccacc
cctgtcctagaagcaccattccctgatgaatacttagaaggtttaacagaagaaatgaag
gaagcgctagatttatctattgaaaatgttcgtaaattccacgctgctcaattgcaaaag
gaacctctagtcgtggaaactcaacctggtgtcatttgttcaagattcccaagaccaatt
gaaagagtgggtttatatattccaggtggtactgctgttttgccaagtacggcattaatg
ttaggtatcccagcccaagtggctcaatgtaaagaaattgtctttgcttctccaccaaga
aaatcggatggtagagtctctcctgaagtcgtctatgtcgcttctcaatgtggtgcttcc
aagatcgttcttgctggtggtgctcaagctgttgccgccatggcttacggtactgaaagt
gttccaaaagtggataagattttaggtccaggcaatcaattcgttaccgctgctaagatg
tacgttcaaaatgatactcaagctctatgttctatagatatgcctgctggtccaagtgaa
gtcctggtcatttgcgatgaagatgccgatgaagattatgtagcaagtgatttgttgtct
caagctgaacatggtattgattctcaagttatattatgtgccatcaatttatctgaagaa
aaaattataagaattcaagaagctgttaacaagcaagcattagctttacctcgtgttgat
attattcgtcaatgtatttcacatagtactatcatattatgtgattcctatgaagaagcg
tttgaaatgtcgaatagatatgctccagaacatttaattttacaaatcaataacgctaat
gattatgttgaattagttgataatgctggtagtatctttgttggtgcttacactccagaa
tcttgtggagattattcaagtggtactaaccataccttaccaacttatggttacgcaaga
caatatagtggtgctaatacttctactttccagaaattcattacggctcaaaatgtcact
ccagaaggtttgaagaatatcggtaaggctgtcatgtgtgttgctaaagtagaaggtctt
gatggccacagaaatgctgttaaggttagaatggaaaaattaggcctactacctcaaggc
ttcgaatag

DBGET integrated database retrieval system