KEGG   Naumovozyma dairenensis: NDAI_0A00710Help
Entry
NDAI_0A00710      CDS       T02234                                 

Gene name
NDAI0A00710
Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ndi  Naumovozyma dairenensis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NDAI_0A00710 (NDAI0A00710)
Enzymes [BR:ndi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     NDAI_0A00710 (NDAI0A00710)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(134887..135894)
Genome map
AA seq 335 aa AA seqDB search
MGITIVGSLNYDLVTYTDRVPDSGETFRANHFETHAGGKGLNQTIATARMKDPKANYKVK
MVGNVGKDSFGEQLLDILRKNNVDVANVGILPNVMTGIATILVEQKDGSGQNRIIITQGA
NGKSTYESGKLENIFPTDSSDRKQMVIFQQEIPNPTSIIHWLNKNRPTYEIVFNPSPFEP
ISAEDWHLVDVLIVNEVEAVQILETIYNNEEIKNYKSAIEKDFVEGYEKICSVLQKTLVS
QSKSAIVVTTLGSKGALFCSKDHPTVGFVPSCKVDSIVDTTGAGDTFLGSLVTQLYQGQD
LEKAMKFSTVASSLSIQKRGAAESMPTFEDVQSSF
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgggtattacaattgtaggttcattgaattatgacctggtgacttacacagatagagtc
ccagattcaggggagacctttcgagcaaatcatttcgagactcatgctggtggaaaaggt
ttaaatcaaactatagctacagcaagaatgaaggatcctaaagctaactataaagttaaa
atggtaggtaacgtcggtaaggattcatttggtgaacaactacttgacattttaaggaag
aataatgtcgatgttgctaacgtgggtatcttaccgaatgtcatgacaggtatagctacc
attctcgtagaacaaaaagatggtagtggtcagaaccgtattattattacacagggtgct
aatggcaaatctacttatgaatcagggaagttagaaaacatcttcccaacagattcaagt
gataggaaacaaatggttatattccaacaagaaattcctaaccctacttcaataattcac
tggttgaataaaaataggcccacgtatgagatagtctttaatccatcgccatttgaaccg
atatctgcagaagattggcatttagttgatgttttgattgtcaacgaagtagaagcagtg
caaattttagaaactatatataacaacgaagaaattaaaaattataaatctgcaattgag
aaggatttcgtagaaggatatgaaaaaatatgctctgttcttcaaaagactctagtaagc
caatctaaatcggctattgtcgtgacaactttaggttctaaaggtgcattattttgctct
aaagatcatccaactgttggatttgttccttcttgtaaagttgattcaattgtcgatacc
actggagcgggtgatacatttttagggtctttagtaacccagttatatcaaggacaagat
ttggaaaaggcaatgaagttttctactgttgctagttccttatcaattcaaaaacgtggc
gctgctgaaagtatgccaaccttcgaggatgtccaatcatctttctaa

DBGET integrated database retrieval system