KEGG   Naumovozyma dairenensis: NDAI_0A00960Help
Entry
NDAI_0A00960      CDS       T02234                                 

Gene name
NDAI0A00960
Definition
(RefSeq) hypothetical protein
Organism
ndi  Naumovozyma dairenensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(197205..198431)
Genome map
AA seq 408 aa AA seqDB search
MYVDPQKHNAVRKLDIDTITKSNENINETAPSSDDNKKQEQQQETQTFNLDSMKERNDQM
NVSESKDNPSGNGHGNEMIQKQNVLGRTTSGKYNLPDFQIMRTLGTGSFGRVHLVRSIHN
GRFYALKVIKKNTVVRLKQIEHTNDERRMLSVVNHPFLVRMWGTFQDSEQIFMIMDYIEG
GELFSLLRRSQKFPNPVAKFYAAEVCLALEYLHSLDIIYRDLKPENILLDKNGHIKITDF
GFAKYVPDVTYTLCGTPDYIAPEVVSSKPYNKSVDWWSFGILIYEMLSGRTPFYDRSTIK
TYENILSAPLTFPSYLHEDVQDLLNRLITRDLSKRLGNLQNGSEDVKNHAWFSEVIWDKL
LARCIETPYEPPISQGQGDTSQFEKYPEEDINYGIKGDDPYADLFKDF
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgtatgtggatcctcagaaacacaatgcagttaggaaattggatatcgatactataacc
aagtccaatgaaaatataaatgaaacagcaccttcttccgacgacaataaaaaacaagaa
caacaacaagaaacacagacattcaatcttgattcaatgaaggaaagaaatgatcaaatg
aatgtcagtgaaagtaaagataacccctcaggtaacggtcacgggaatgaaatgatacaa
aaacaaaatgtccttggcagaacgacgtcagggaaatataatttacctgatttccaaatt
atgagaacattagggacaggttccttcggtagagtacatctcgttagatcgattcataat
ggacgattttatgctctgaaagtgataaaaaaaaacactgttgtaagattaaaacaaatt
gaacatacaaatgatgaacgtcgaatgttatccgtagtcaatcatccatttctagttaga
atgtgggggacatttcaagattcagaacaaatttttatgattatggattatattgaaggt
ggtgaattgttttcgttattaagaaggtcacaaaaatttcctaatccagtggctaaattt
tatgctgcagaagtttgtctcgcattagaataccttcatagtttggatataatatacagg
gatttgaaacctgaaaacattcttctagataagaatggtcatataaagataacggatttt
ggatttgcgaaatatgtaccagacgtcacttatacattatgtggtacaccagattatatt
gctccagaagtggttagtagtaaaccttacaataaatccgtggattggtggagttttgga
atactgatttatgagatgttatccggacgaacaccattttatgaccgtagtacaataaaa
acatacgaaaacatattaagtgctccgttgacttttccatcatatctccatgaggatgta
caagatcttttaaatagattaattacaagagatctaagtaaaaggttaggtaatctgcaa
aatggaagtgaagatgttaaaaaccatgcttggtttagtgaagtaatatgggacaaattg
ttggctcgatgtatcgaaacaccatatgagcctcctattagccaaggacaaggagataca
tcacagtttgaaaaataccctgaggaagatataaactatggtattaaaggtgatgatcca
tatgctgatctattcaaagacttttaa

DBGET integrated database retrieval system