KEGG   Naumovozyma dairenensis: NDAI_0A01020Help
Entry
NDAI_0A01020      CDS       T02234                                 

Gene name
NDAI0A01020
Definition
hypothetical protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
ndi  Naumovozyma dairenensis
Brite
Enzymes [BR:ndi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     NDAI_0A01020 (NDAI0A01020)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:217456..218568
Genome map
AA seq 370 aa AA seqDB search
MSTTAASFAAKRFVPKIIPRTFNKKSFYFITAATAAAGTAALTASLYDSNKRRRNNYQKN
NNNNNNGFSSGAKFMAAAAPIIHLASAPKDKTQEDYQKVYNAIAEKIREDDDYDNYIGYG
PVLVRLAWHCSGTWDKNDNTGGSFNGTYRFKQECNDPSNKGLQNAGEFLKPIFEEFPWIS
HGDLYTLGGVTAVQEMQGPKIPWRPGRVDQPESATPANGRLPDADTDAKYVRNYFARLNM
NDREVVALMGAHALGKTHLENTGYEGPWGFANNTFTNEFFLNLLNEDWKWEKNEAGNMQW
GSDKGFMMLPADMALVQDPKYLPIVKEYANDLDTFCKDFAKAFSKLLENGITYPEDSKPM
YFKTLDEQDI
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgtccactacagctgcatccttcgctgcaaagaggttcgtaccaaagatcattcctcga
acattcaacaagaaatcattctatttcatcactgctgctactgctgccgctggtaccgct
gcattaactgcttccctttacgactccaacaagagaagaagaaacaactatcaaaaaaac
aataacaataacaacaatggattctcatctggagcaaaattcatggcagcagcagctccc
ataattcacttagcttccgcaccaaaggacaaaacacaagaagattatcaaaaagtttac
aacgccatcgctgagaagatcagagaagatgatgattacgataactatatcggatatggc
cccgtcttagtacgtctagcatggcattgttccggaacatgggataagaacgataatacg
ggtggttcattcaacggtacgtatagattcaagcaagaatgtaatgatccttctaataag
ggattacaaaatgctggagagtttttaaagcctatctttgaagaatttccttggatttct
catggtgatttgtatactttaggtggtgttactgcggtacaagaaatgcaaggtccaaag
attccttggagaccagggagagttgatcaacctgaaagtgctactcctgctaatgggaga
ttgcctgatgcggatactgatgcgaaatatgttagaaattactttgctagattgaatatg
aatgatagagaagtggttgccttgatgggtgctcatgctttggggaagactcatttggaa
aatactggttatgaaggtccatgggggttcgctaataatactttcactaatgaattcttt
ttgaatttattgaatgaagattggaaatgggaaaaaaatgaagctgggaacatgcaatgg
ggttctgataagggtttcatgatgttacctgctgatatggcattggttcaagatccgaaa
tatttgcctatcgttaaagaatacgctaatgatctggatactttctgtaaggatttcgca
aaggcattctccaagttactagaaaacggtatcacttatccggaagatagcaaaccaatg
tacttcaaaactttagacgaacaagatatctga

DBGET integrated database retrieval system