KEGG   Naumovozyma dairenensis: NDAI_0A01240Help
Entry
NDAI_0A01240      CDS       T02234                                 

Gene name
NDAI0A01240
Definition
hypothetical protein
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ndi  Naumovozyma dairenensis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NDAI_0A01240 (NDAI0A01240)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NDAI_0A01240 (NDAI0A01240)
   00620 Pyruvate metabolism
    NDAI_0A01240 (NDAI0A01240)
   00640 Propanoate metabolism
    NDAI_0A01240 (NDAI0A01240)
  Energy metabolism
   00680 Methane metabolism
    NDAI_0A01240 (NDAI0A01240)
Enzymes [BR:ndi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     NDAI_0A01240 (NDAI0A01240)
Lipid biosynthesis proteins [BR:ndi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   NDAI_0A01240 (NDAI0A01240)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:268537..270585
Genome map
AA seq 682 aa AA seqDB search
MSIKQHKVVHEAQGVEVRQAPDHFYNSQPGASYINDMDHYRQLYDQSINDPEKFFGEKAN
EFLAWDKPFTKVKSGSLEHGDAAWFLNGELNASYNCVDRHAFVDPNKPAIIYEADDENEN
RTITFGELLRQVSQVAGVLKSWGVKKGDTVGVYLPMIPEAIVAMLAVARLGAIHSVIFAG
FSAGSLKDRIVDAGCKVVITCDEGKRGGKTVHTKKIVDEGLNGVDSVSHILVFQRTGSEG
ISMKAGRDFWWHQEIEKQRRYLPAVPCNAEDPLFLLYTSGSTGTPKGVVHTTGGYLLGAA
LTTRYVFDIHPEDVLFTAGDVGWITGHTYALYGPLVLGTATIIFESTPAYPDYGRYWRII
ERHRATHFYVAPTALRLIKRVGEAEIAKYDTSSLRVLGSVGEPISPDLWEWYHEKVGNKD
CVVCDTMWQTESGSHLIAPLAGAVPTKPGSATVPFFGIEACIIDPVTGVELEGNDVEGVL
AVKNTWPSMARSIWNNHSHYINTYLKPYPGYYFTGDGAGRDHDGYYWIRGRVDDVVNVSG
HRLSTAEIEASLVNNEHVSEAAVVGIADELTGQAVVAFVSLKKSFVQENAEEGDFEHATP
TELRRELILQVRTEIGPFAAPKNIVLIRDLPKTRSGKIMRRVLRKIASNEADQLGDLSTL
ANADIVPSIITAVENQFLAAKK
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgtctatcaaacaacataaagttgtccatgaagctcaaggcgttgaagtccgtcaagct
ccagaccatttctacaatagtcaaccaggagccagttatatcaatgacatggatcactac
cgtcaattatatgatcaatctatcaatgatcctgaaaaattctttggtgaaaaagccaat
gaatttttagcatgggataaaccattcacaaaggtcaaatctggttcattggaacatggt
gatgctgcatggttcttaaatggtgaattgaacgcttcttataattgtgtcgatagacat
gcgttcgtggatccaaataaacctgctatcatttatgaagctgatgatgaaaatgaaaat
agaactatcacatttggtgaattattaagacaagtgtctcaagtagctggtgtcttgaaa
agttggggtgttaagaaaggtgatacagttggtgtttatttaccaatgattcctgaagct
attgttgccatgttggccgtcgcacgtcttggtgctattcattccgtcatatttgccggt
ttttctgcaggttctttgaaagatcgtatcgtggatgccggttgtaaagtagttataact
tgtgatgaaggtaaaagaggtggtaagaccgttcatactaagaagattgttgatgaaggt
ttgaatggtgtagattctgtttctcatatcttggttttccaaagaactggttctgaagga
atctccatgaaggcaggcagagatttttggtggcatcaagaaattgaaaagcaaagaaga
tacttgccagctgttccatgcaatgctgaagatccattatttctattatatacttctggt
tccactggtactccaaagggtgttgttcataccactggtggttatttattaggtgcagca
ttaactacaagatatgtctttgatattcatccagaagatgtgttattcaccgctggtgat
gttggttggattactggtcatacttatgcattatatggtccattagttctaggtaccgca
actatcatatttgaatctactcctgcatatccggattatgggagatattggagaatcatt
gaacgtcatagagctacgcatttctatgtagcaccaactgcgttaagattaattaaacgt
gtaggtgaagcggaaattgccaaatatgatacatcttcattaagagttcttggatctgtt
ggtgaacctatttctccagatttatgggaatggtaccatgaaaaagttggtaataaagat
tgtgtggtttgtgacactatgtggcaaactgaatctggttctcatttaattgcaccatta
gctggtgcagttccaactaaacctggctctgctacagttccattctttggtattgaagct
tgtataattgatcctgtcactggtgttgaattggaaggcaatgatgtggaaggtgtctta
gcagttaaaaacacatggccatccatggctagatctatttggaataaccatagtcattat
atcaacacatacttgaagccatatccaggttattacttcacaggtgatggtgcaggtaga
gatcatgatggttattattggattagaggtagagtagatgatgttgttaacgtttcaggt
catagattatctacagcagaaattgaagcatccttagttaacaatgaacatgtttctgaa
gctgcagttgttggtattgctgatgaattaactggtcaagcggttgttgcatttgtttcc
ttaaagaaatcatttgttcaagaaaatgcagaagagggtgattttgaacatgcaacgcca
actgaattacgtcgtgaattgatcttacaagtgagaacagaaattggaccatttgcggct
cctaagaatattgtattaataagagatttaccaaagacaaggtctggtaagattatgaga
agagttttgagaaaaattgcatctaatgaagcggatcaattaggagatttatctactttg
gctaatgctgatattgttccatctattataacagctgttgaaaaccagtttttggcagcc
aaaaaatga

DBGET integrated database retrieval system