KEGG   Naumovozyma dairenensis: NDAI_0A01240Help
Entry
NDAI_0A01240      CDS       T02234                                 

Gene name
NDAI0A01240
Definition
hypothetical protein
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ndi  Naumovozyma dairenensis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:ndi01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ndi00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ndi00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:ndi00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:ndi00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:268537..270585
Genome map
AA seq 682 aa AA seqDB search
MSIKQHKVVHEAQGVEVRQAPDHFYNSQPGASYINDMDHYRQLYDQSINDPEKFFGEKAN
EFLAWDKPFTKVKSGSLEHGDAAWFLNGELNASYNCVDRHAFVDPNKPAIIYEADDENEN
RTITFGELLRQVSQVAGVLKSWGVKKGDTVGVYLPMIPEAIVAMLAVARLGAIHSVIFAG
FSAGSLKDRIVDAGCKVVITCDEGKRGGKTVHTKKIVDEGLNGVDSVSHILVFQRTGSEG
ISMKAGRDFWWHQEIEKQRRYLPAVPCNAEDPLFLLYTSGSTGTPKGVVHTTGGYLLGAA
LTTRYVFDIHPEDVLFTAGDVGWITGHTYALYGPLVLGTATIIFESTPAYPDYGRYWRII
ERHRATHFYVAPTALRLIKRVGEAEIAKYDTSSLRVLGSVGEPISPDLWEWYHEKVGNKD
CVVCDTMWQTESGSHLIAPLAGAVPTKPGSATVPFFGIEACIIDPVTGVELEGNDVEGVL
AVKNTWPSMARSIWNNHSHYINTYLKPYPGYYFTGDGAGRDHDGYYWIRGRVDDVVNVSG
HRLSTAEIEASLVNNEHVSEAAVVGIADELTGQAVVAFVSLKKSFVQENAEEGDFEHATP
TELRRELILQVRTEIGPFAAPKNIVLIRDLPKTRSGKIMRRVLRKIASNEADQLGDLSTL
ANADIVPSIITAVENQFLAAKK
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgtctatcaaacaacataaagttgtccatgaagctcaaggcgttgaagtccgtcaagct
ccagaccatttctacaatagtcaaccaggagccagttatatcaatgacatggatcactac
cgtcaattatatgatcaatctatcaatgatcctgaaaaattctttggtgaaaaagccaat
gaatttttagcatgggataaaccattcacaaaggtcaaatctggttcattggaacatggt
gatgctgcatggttcttaaatggtgaattgaacgcttcttataattgtgtcgatagacat
gcgttcgtggatccaaataaacctgctatcatttatgaagctgatgatgaaaatgaaaat
agaactatcacatttggtgaattattaagacaagtgtctcaagtagctggtgtcttgaaa
agttggggtgttaagaaaggtgatacagttggtgtttatttaccaatgattcctgaagct
attgttgccatgttggccgtcgcacgtcttggtgctattcattccgtcatatttgccggt
ttttctgcaggttctttgaaagatcgtatcgtggatgccggttgtaaagtagttataact
tgtgatgaaggtaaaagaggtggtaagaccgttcatactaagaagattgttgatgaaggt
ttgaatggtgtagattctgtttctcatatcttggttttccaaagaactggttctgaagga
atctccatgaaggcaggcagagatttttggtggcatcaagaaattgaaaagcaaagaaga
tacttgccagctgttccatgcaatgctgaagatccattatttctattatatacttctggt
tccactggtactccaaagggtgttgttcataccactggtggttatttattaggtgcagca
ttaactacaagatatgtctttgatattcatccagaagatgtgttattcaccgctggtgat
gttggttggattactggtcatacttatgcattatatggtccattagttctaggtaccgca
actatcatatttgaatctactcctgcatatccggattatgggagatattggagaatcatt
gaacgtcatagagctacgcatttctatgtagcaccaactgcgttaagattaattaaacgt
gtaggtgaagcggaaattgccaaatatgatacatcttcattaagagttcttggatctgtt
ggtgaacctatttctccagatttatgggaatggtaccatgaaaaagttggtaataaagat
tgtgtggtttgtgacactatgtggcaaactgaatctggttctcatttaattgcaccatta
gctggtgcagttccaactaaacctggctctgctacagttccattctttggtattgaagct
tgtataattgatcctgtcactggtgttgaattggaaggcaatgatgtggaaggtgtctta
gcagttaaaaacacatggccatccatggctagatctatttggaataaccatagtcattat
atcaacacatacttgaagccatatccaggttattacttcacaggtgatggtgcaggtaga
gatcatgatggttattattggattagaggtagagtagatgatgttgttaacgtttcaggt
catagattatctacagcagaaattgaagcatccttagttaacaatgaacatgtttctgaa
gctgcagttgttggtattgctgatgaattaactggtcaagcggttgttgcatttgtttcc
ttaaagaaatcatttgttcaagaaaatgcagaagagggtgattttgaacatgcaacgcca
actgaattacgtcgtgaattgatcttacaagtgagaacagaaattggaccatttgcggct
cctaagaatattgtattaataagagatttaccaaagacaaggtctggtaagattatgaga
agagttttgagaaaaattgcatctaatgaagcggatcaattaggagatttatctactttg
gctaatgctgatattgttccatctattataacagctgttgaaaaccagtttttggcagcc
aaaaaatga

DBGET integrated database retrieval system