KEGG   Naumovozyma dairenensis: NDAI_0A01380Help
Entry
NDAI_0A01380      CDS       T02234                                 

Gene name
NDAI0A01380
Definition
hypothetical protein
Orthology
K06634  
cyclin H
Organism
ndi  Naumovozyma dairenensis
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    NDAI_0A01380 (NDAI0A01380)
  Replication and repair
   03420 Nucleotide excision repair
    NDAI_0A01380 (NDAI0A01380)
Transcription machinery [BR:ndi03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     NDAI_0A01380 (NDAI0A01380)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:308576..309730
Genome map
AA seq 384 aa AA seqDB search
MSDTSPLVVTSKENTPAASQKSKIDAAGTEVVATDGTTESEDSNKPLNYNRITDDELYRH
SSQYRFWSFSKEHLREKRDMTNKLAVETIEKDLFDFKALNDLTPEELNALDTKAVPLTTE
EELKLIDFYAKKVQVISQHLNLPTEIIATSISFFRKFFLENSVMQFDPKNLVHTTVFLAC
KAENYFISVDSFAKKAKSTRESILKYEFKLLESLKFTLLIHHPYKPLHGFFLDIQNILHG
KVDLNYMGQIYDRTKKKITQALLTDAVYLYTPPQITLAVLLIEDEPLITKYLELKFADND
NDDNGNEVKRKKKNSIDLTVLLSVIKECKDVIENLQTVSTEDARKIAAKNYFCQNPKALI
QNLKRKQQQAGSSTEPEQKKQRTE
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacacctctccgttggtggttacatcgaaggaaaacacccctgctgcaagccag
aaatccaaaattgatgctgcaggaacagaagttgttgctactgatggtaccactgaatct
gaggattcaaataagcctttaaactataatagaataacggatgatgagttatataggcat
tcttcacaatacagattttggtctttctcgaaggaacatctgagggagaaaagagacatg
acaaataaactggctgttgaaacgatagagaaagacctgtttgatttcaaagcactaaat
gatcttactccagaggaactcaatgctttagatacgaaagctgtacctttgacaaccgag
gaagaattaaaattgatagatttttacgctaagaaagttcaagtgatatcacaacatttg
aatctacctaccgaaataatcgctacatcaatttcatttttcaggaaattttttctagag
aactcagtgatgcaatttgatcccaagaatttagttcatacgactgtgtttttggcctgt
aaagcagaaaattatttcattagcgtggactcctttgctaaaaaagctaaatctacaaga
gagtcaatattaaaatatgaatttaaattattagaaagtttaaagtttacacttttaatt
catcatccttataaaccattacatgggtttttcctagatattcagaatattttacatggt
aaagttgatttgaattatatgggtcaaatttatgatagaacaaagaagaaaatcacgcaa
gccctgctgacagatgctgtatatctatatacacctccacaaatcacactggctgtgtta
ttaattgaggatgagccgttaataacgaaatatttagaattgaaattcgccgacaacgat
aatgatgataacggtaatgaagtgaagaggaagaagaagaattccattgatttaacagta
ttactatctgtaataaaagaatgtaaagatgttattgaaaacctacaaacggtctccaca
gaagatgcaaggaaaattgccgccaagaactatttttgccagaatcctaaagccttaatt
cagaatttgaaaaggaaacaacagcaagctggaagtagtacagaacctgaacaaaagaag
caaagaactgaataa

DBGET integrated database retrieval system