KEGG   Naumovozyma dairenensis: NDAI_0A01560Help
Entry
NDAI_0A01560      CDS       T02234                                 

Gene name
NDAI0A01560
Definition
hypothetical protein
Orthology
K14298  
mRNA export factor
Organism
ndi  Naumovozyma dairenensis
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    NDAI_0A01560 (NDAI0A01560)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:352038..353129
Genome map
AA seq 363 aa AA seqDB search
MAFYSSSSSSSGPTQTMATEKDLANDIVVNNPAEDSISDIAFSPQQDFLFSSSSWDGKVR
IWDVQNGIAQGRSQYEHMGPVLTTRWSNDGTKVASGGCDNIVKLFDVASGQNQQIGAHDA
PVKVLRFVNCGPTNTECLVTGSWDKSIKYWDLRQAQPITTLMMPDRVYAMDSKQQLLVVG
TAERHIAIINLSNPTTIFKTILSPLKWQTRVISCYNEGDGYAVGSVEGRCAIRYVDDEVQ
KKSGFSFKCHRQTSPNRAPGSQGQSMVYPLNSIAFHPVYGTFVTAGGDGSFHFWDKNHRH
RLRGFPSLQASIPVVSFNRSGSVMAYALSYDWHQGYMGNRPDYPNVIRLHPTTDDEVKEK
RKR
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggcattctattcaagttcatcgagttcatcagggccgactcaaacaatggccaccgag
aaggatttggcaaatgatattgtagtaaataacccagcagaagactccatttcagatatt
gccttcagtcctcagcaagatttcttatttagtagcagttcttgggatggaaaagttcga
atttgggatgttcagaatggtatagcacaaggtagaagccaatatgaacatatggggcct
gtcttaacgacaagatggtcaaacgatggtaccaaagtagcatcaggtggctgtgataat
attgtcaaattgtttgatgtagcaagtggacaaaatcaacaaattggtgctcatgatgct
ccagtgaaagtcttaagatttgttaattgtggtccaacaaatacagagtgcttagttaca
gggtcatgggataaatctattaaatattgggacttaaggcaagcacaaccaattactact
ttaatgatgccagatcgtgtttatgcgatggatagtaaacaacaacttttagttgttggt
acagctgaaaggcatattgcaataataaatttaagtaatcctacaaccatcttcaagacg
atattatctccattgaaatggcagactcgagttatttcatgttataatgaaggtgacggt
tatgcggttggatctgttgaaggtagatgtgccattaggtatgttgatgatgaagtacaa
aagaaatctggattttcatttaaatgtcatagacaaacaagtcccaatagagcacctggc
tcacaaggtcaatcaatggtttatcctcttaatagtatagcattccatcctgtctatggt
acattcgttacagcaggtggtgatgggtcattccatttttgggataagaatcatagacat
agattaagagggttcccatcattacaagcatcaatccctgtagtaagttttaatagaagt
ggttcagtaatggcttatgctttaagttatgattggcatcaaggatatatgggtaataga
cctgattatccaaatgtcatcagattacatccaacaactgatgatgaagtgaaagaaaag
aggaaacgttaa

DBGET integrated database retrieval system