KEGG   Naumovozyma dairenensis: NDAI_0A01670Help
Entry
NDAI_0A01670      CDS       T02234                                 

Gene name
NDAI0A01670
Definition
hypothetical protein
Orthology
K11872  
ubiquitin carboxyl-terminal hydrolase 9/13 [EC:3.1.2.15]
Organism
ndi  Naumovozyma dairenensis
Brite
Enzymes [BR:ndi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     NDAI_0A01670 (NDAI0A01670)
Peptidases [BR:ndi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   NDAI_0A01670 (NDAI0A01670)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(368070..370610)
Genome map
AA seq 846 aa AA seqDB search
MLKRLLSVNKPNKKKHAIDKNETKDKSHTHSHLHSSDIQHHSSRDHIHAKHTTDVESMNN
HSHNHTHHPHNNHNSHHEKILEPNTSECIQEEKVKEEEGEEKEDENEERKVLAMHPTEPS
KVVPPLPPPSRNTSKKQVPATIVNNDDTLNSAILFTPVSDLIPYGDGSNKVFGYENFGNT
CYCNSVLQCLYNLYEFRLNMLEYSDHLPHNYANIENRRIRKLDMKGLKPRIFTEASFDSN
NNKPNTTTITNTSSNDNEIDNNNNINNNETYQDYNNLNSKNTTNNNNNNNNKRNSFMGFQ
VPSKQQYNNNKDTTVNNKQDGNNNNNNNNNSTNNAKSQSYTAKMSSLLGAATSNSNPNME
NGKDKNGNVNTQDDGIIHATLMSSDVTTEKLHSGCQDILVGRINNNNNNNRFTKQQKPNI
IDELSNSKESYTPIFSKTNNNNNNNNNNNIPHNIPSNNIVTPVQKPTSEQRKKAALINGP
VLNVDHLLNQYEKANLYNSLKDIFESITENRYLTGIVAPTEFVKILKKENVLFNSMMQQD
SHEFLNFLLNELRDYLPSTTNNFITNLFQGILTNQIKCLTCDNITSRDEPFLDFPIGVKD
DEETNIETLLRNYHTREMLNGSNKFYCNQCCGLQEAERIVGLKQLPHILALHLKRFKYSE
VKNTNIKLFNKVYYPLTLNVASTFDSSIEKAYELTGVVIHMGSSPQHGHYVSLCKNDKFG
WLLFDDETVESVSESTVLEFTGDPNNQATAYVLFYKEIKDIVKYYHSIETHHDKFKNNIN
ELIKCDDAIRIEQEKQRKIQKKLHDEQMERERLSMNELDKNIERKGSHSANNKTKRKSRI
LSFMKS
NT seq 2541 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaaagactactttcagttaataaaccgaacaagaagaagcatgcaatagataaa
aatgaaacgaaggataagtctcatacacattcacatcttcattcctctgatattcaacat
catagtagtcgagatcatatacatgcaaagcatacaactgacgtagaatcaatgaataac
catagtcataatcacactcaccatccacataataatcataactctcaccatgagaaaata
ttagaaccaaatacttcagaatgcatacaagaagaaaaggtcaaagaagaagagggagaa
gaaaaagaagatgaaaatgaggaaagaaaagttttggccatgcatccgacagagccttca
aaggtagtacctcctttacctccaccttctcgtaacacctcgaagaagcaagtcccagct
acaattgtgaacaacgacgatacactgaactcggcaatccttttcactcctgtatcagat
ctaataccatatggtgatggatcaaataaagtattcggttatgaaaatttcgggaataca
tgctattgtaattctgtcttacaatgtctttacaatttatacgaatttagattgaatatg
ttggaatattcagaccatcttcctcacaactatgctaatattgaaaatagaagaataagg
aaattagatatgaaaggattgaaaccaagaattttcactgaagctagtttcgattccaat
aataataagcctaacacgactactattactaacacctcaagtaatgataatgaaatagat
aacaataacaatattaataataacgaaacataccaagattataataatctcaattccaaa
aatactacgaataataataataataataacaataaaagaaactcattcatgggcttccaa
gttcctagcaaacaacaatataataacaataaagataccaccgtgaataataagcaagat
gggaataataataataataataataataatagtactaataatgcaaagagtcaatcatat
actgccaagatgagttcattacttggagcagcaacatcaaattcaaatccaaatatggaa
aacgggaaagataaaaatggcaacgttaatactcaagatgatgggatcattcatgccact
ttaatgtcctctgatgtaacgacagaaaaattacattctggttgtcaagatatattagtc
ggtagaataaataataacaataataataatagattcactaagcaacaaaaaccaaatatt
attgatgaattatcaaatagcaaagaatcatatactccaatcttttctaaaaccaataac
aataacaataacaataacaataacaatataccacataatataccaagtaataacattgtt
acaccagtgcaaaaaccaacaagtgagcaaaggaaaaaagcagcattaataaacggtccc
gtcttgaacgtagatcatttattaaatcaatacgagaaggcaaacttatacaactcttta
aaggatattttcgaaagtataacagaaaacagatacttaacgggtatagttgcccccact
gaattcgtgaagattttgaaaaaagaaaatgtacttttcaattcaatgatgcaacaagat
tctcatgaatttttaaatttcttactaaatgaactacgtgattatttaccatccacaaca
aataattttattacaaacctattccaaggtatattaactaatcaaataaaatgtttaact
tgtgataacatcacttcaagagatgaaccgttcttagatttccccattggtgttaaagat
gacgaggaaacaaacattgaaacgttattaaggaattatcatactagagaaatgttgaat
ggatccaataaattttattgtaatcaatgttgcggacttcaagaagctgaaagaatagtg
gggttgaaacaattacctcatattttggcattacatttgaaaagatttaaatattctgag
gtgaagaatacaaatattaagttattcaataaagtttattatccattgactttgaatgta
gcatctacttttgattcatcaattgaaaaagcttatgaattaactggggttgtgattcat
atggggagtagtccacaacatggccattatgtttcattatgtaagaatgataaatttggt
tggttattatttgatgatgaaactgtggaatctgtttctgaaagtacggtattggaattc
actggagatccaaataatcaggctactgcatatgttttattttataaggagatcaaagat
atcgtgaaatattatcatagtattgaaactcatcatgataaatttaagaataatattaat
gaattaattaaatgtgatgatgcaataagaattgaacaagaaaagcaaaggaaaattcaa
aaaaaattacatgacgaacaaatggaaagggaaaggctgtcaatgaatgagttggataag
aatattgagagaaaggggtctcattcagccaataataagacgaaaaggaagtcaaggatc
ttgagtttcatgaagagttga

DBGET integrated database retrieval system