KEGG   Naumovozyma dairenensis: NDAI_0A01970Help
Entry
NDAI_0A01970      CDS       T02234                                 

Gene name
NDAI0A01970
Definition
hypothetical protein
Orthology
K11226  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
ndi  Naumovozyma dairenensis
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    NDAI_0A01970 (NDAI0A01970)
Enzymes [BR:ndi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     NDAI_0A01970 (NDAI0A01970)
Protein kinases [BR:ndi01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   NDAI_0A01970 (NDAI0A01970)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:440268..442184
Genome map
AA seq 638 aa AA seqDB search
MNPFQTRSLQRKNTKNLELGNNKNTLNSNTCVSDAIPPRLSKIEGRNRDPIILTNLNCNN
DRTVTSKKLFLERNLQKSPKERTYQSSLSPSPSSVSPLSSPNESPSHKLNFANKGSLYLR
RGLKKKLTLDPTPSLSEPLPLNPLEIKKPHSQQTVETSSVHSQVKTIKRKVPPSPLKLTN
NNNTINNIQSHQTTVIKNDTIIIQQQEDSDSPYKSIASPLYNNNKSSTSSPTLIVPTTNT
TNNSSGGSTSPQHTIPTTDSIYQLQDLVQLGKIGSGNSGTVVKTLHVPTSKIIAKKTIPL
EKNNEIILNQLIRELTIMKSVKSHKNIISFYGAYYDNVKNNEIIILMEYMDCGSLDKILL
TYKRLVNRGFIDSKLKNWFNDSLILSKLSYAVLNGLDYLYTNYKIIHRDIKPSNILVNSK
GQVKICDFGVSKKLINSIADTFVGTSTYMSPERIQGNVYSTKGDVWSLGLVIIELVTGKF
PLSLNNNNSNHNNNNNNNNNNNKNKNNNRNSDNDNIINNNNNSPDGILDLLQRIVNEPSP
KLPRDNNNYQFPTEMIDFVNKCCIKEEKNRSSIHELLAHDFILMYSDKLYNKEFKMWCKM
IKSYIKQDRQFKREDIERAKFEKRQLEKSSEAAKKNRH
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgaatccatttcaaacgagaagcttacaaaggaaaaatacaaaaaacctagaattaggt
aacaacaagaatactttaaattctaatacatgtgtaagtgacgcgattcctccacgcctc
agtaaaatagagggaagaaatcgagacccgattatattgactaatcttaattgcaacaat
gatagaacagtaacatccaagaaattatttctagaacgtaatttacaaaaatcacccaag
gagcgaacataccagtcttctttgtctccttcaccgtcgtctgtttcacctctatcttct
ccgaatgaatcaccatcacacaaactaaattttgctaacaagggtagtttataccttcga
agaggtttaaagaaaaaactgacgttagatccaacaccatcactctctgaaccgttaccc
ctgaatccattagaaataaaaaagccacactctcaacaaacagtagaaacgtcatcggta
cattctcaagtgaaaacaattaaacgtaaggttccaccgtcacctctgaaactcacaaat
aataataataccataaataatatccaaagtcatcaaactactgtaataaaaaatgatacc
ataataatacaacaacaggaagattcagattctccttataaatccattgcatcaccacta
tacaataataataaaagttcaacttcatctccaacattgatagtgccaactacaaacaca
actaataatagcagtggagggagcacatcaccacaacatacaatacctacgacagattcc
atataccaattacaagatttagtccaattaggtaagattggatcaggtaattcaggtaca
gtagtcaagacactccacgtaccaacatccaaaataatagctaaaaagacaatccccctt
gagaaaaacaatgaaatcatattgaaccaactaattagagaattaacgataatgaaaagt
gtcaaatcacataaaaatatcatatcattctatggtgcatactatgacaatgtgaaaaat
aatgaaattatcatattaatggaatatatggattgcggctcgttagataaaatcttatta
acttataaaagactggttaatcgtggattcattgattccaaattgaaaaattggttcaat
gattctttgatactttcaaaattatcatacgcagttttaaatgggctagattatctttat
actaattataaaattattcatagagatattaagccttctaatattttggttaatagtaaa
ggacaagtgaaaatttgtgatttcggtgtttcaaaaaaattaataaactcaattgctgat
acttttgtcgggacttctacttatatgtcaccggaaagaattcaaggtaatgtttattcg
acaaaaggagacgtttggtcattaggtttagtcattatagaattggtaacaggcaagttc
ccattaagtttaaataataataacagcaatcataataataataataataataataataat
aataataaaaataaaaataataataggaattctgataatgataacatcattaataacaat
aataattctccagatggcattcttgatttactacaaagaatcgttaatgaaccatctcca
aagttacccagagataataataattatcagttcccaacggaaatgatagatttcgtcaat
aaatgttgtattaaagaggagaaaaatagatcatcaattcatgaattgttagctcatgat
ttcattttaatgtacagtgataaattatataacaaagaattcaaaatgtggtgcaaaatg
attaaatcttatattaaacaagatagacagtttaaacgtgaagatattgaacgtgctaaa
tttgaaaaaagacaattagaaaaatcaagtgaagctgctaagaagaatagacattga

DBGET integrated database retrieval system