KEGG   Naumovozyma dairenensis: NDAI_0A01970Help
Entry
NDAI_0A01970      CDS       T02234                                 

Gene name
NDAI0A01970
Definition
hypothetical protein
Organism
ndi  Naumovozyma dairenensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:440268..442184
Genome map
AA seq 638 aa AA seqDB search
MNPFQTRSLQRKNTKNLELGNNKNTLNSNTCVSDAIPPRLSKIEGRNRDPIILTNLNCNN
DRTVTSKKLFLERNLQKSPKERTYQSSLSPSPSSVSPLSSPNESPSHKLNFANKGSLYLR
RGLKKKLTLDPTPSLSEPLPLNPLEIKKPHSQQTVETSSVHSQVKTIKRKVPPSPLKLTN
NNNTINNIQSHQTTVIKNDTIIIQQQEDSDSPYKSIASPLYNNNKSSTSSPTLIVPTTNT
TNNSSGGSTSPQHTIPTTDSIYQLQDLVQLGKIGSGNSGTVVKTLHVPTSKIIAKKTIPL
EKNNEIILNQLIRELTIMKSVKSHKNIISFYGAYYDNVKNNEIIILMEYMDCGSLDKILL
TYKRLVNRGFIDSKLKNWFNDSLILSKLSYAVLNGLDYLYTNYKIIHRDIKPSNILVNSK
GQVKICDFGVSKKLINSIADTFVGTSTYMSPERIQGNVYSTKGDVWSLGLVIIELVTGKF
PLSLNNNNSNHNNNNNNNNNNNKNKNNNRNSDNDNIINNNNNSPDGILDLLQRIVNEPSP
KLPRDNNNYQFPTEMIDFVNKCCIKEEKNRSSIHELLAHDFILMYSDKLYNKEFKMWCKM
IKSYIKQDRQFKREDIERAKFEKRQLEKSSEAAKKNRH
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgaatccatttcaaacgagaagcttacaaaggaaaaatacaaaaaacctagaattaggt
aacaacaagaatactttaaattctaatacatgtgtaagtgacgcgattcctccacgcctc
agtaaaatagagggaagaaatcgagacccgattatattgactaatcttaattgcaacaat
gatagaacagtaacatccaagaaattatttctagaacgtaatttacaaaaatcacccaag
gagcgaacataccagtcttctttgtctccttcaccgtcgtctgtttcacctctatcttct
ccgaatgaatcaccatcacacaaactaaattttgctaacaagggtagtttataccttcga
agaggtttaaagaaaaaactgacgttagatccaacaccatcactctctgaaccgttaccc
ctgaatccattagaaataaaaaagccacactctcaacaaacagtagaaacgtcatcggta
cattctcaagtgaaaacaattaaacgtaaggttccaccgtcacctctgaaactcacaaat
aataataataccataaataatatccaaagtcatcaaactactgtaataaaaaatgatacc
ataataatacaacaacaggaagattcagattctccttataaatccattgcatcaccacta
tacaataataataaaagttcaacttcatctccaacattgatagtgccaactacaaacaca
actaataatagcagtggagggagcacatcaccacaacatacaatacctacgacagattcc
atataccaattacaagatttagtccaattaggtaagattggatcaggtaattcaggtaca
gtagtcaagacactccacgtaccaacatccaaaataatagctaaaaagacaatccccctt
gagaaaaacaatgaaatcatattgaaccaactaattagagaattaacgataatgaaaagt
gtcaaatcacataaaaatatcatatcattctatggtgcatactatgacaatgtgaaaaat
aatgaaattatcatattaatggaatatatggattgcggctcgttagataaaatcttatta
acttataaaagactggttaatcgtggattcattgattccaaattgaaaaattggttcaat
gattctttgatactttcaaaattatcatacgcagttttaaatgggctagattatctttat
actaattataaaattattcatagagatattaagccttctaatattttggttaatagtaaa
ggacaagtgaaaatttgtgatttcggtgtttcaaaaaaattaataaactcaattgctgat
acttttgtcgggacttctacttatatgtcaccggaaagaattcaaggtaatgtttattcg
acaaaaggagacgtttggtcattaggtttagtcattatagaattggtaacaggcaagttc
ccattaagtttaaataataataacagcaatcataataataataataataataataataat
aataataaaaataaaaataataataggaattctgataatgataacatcattaataacaat
aataattctccagatggcattcttgatttactacaaagaatcgttaatgaaccatctcca
aagttacccagagataataataattatcagttcccaacggaaatgatagatttcgtcaat
aaatgttgtattaaagaggagaaaaatagatcatcaattcatgaattgttagctcatgat
ttcattttaatgtacagtgataaattatataacaaagaattcaaaatgtggtgcaaaatg
attaaatcttatattaaacaagatagacagtttaaacgtgaagatattgaacgtgctaaa
tttgaaaaaagacaattagaaaaatcaagtgaagctgctaagaagaatagacattga

DBGET integrated database retrieval system