KEGG   Naumovozyma dairenensis: NDAI_0A02580Help
Entry
NDAI_0A02580      CDS       T02234                                 

Gene name
NDAI0A02580
Definition
hypothetical protein
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
ndi  Naumovozyma dairenensis
Brite
Enzymes [BR:ndi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     NDAI_0A02580 (NDAI0A02580)
    1.3.1.94  polyprenol reductase
     NDAI_0A02580 (NDAI0A02580)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:575465..576223
Genome map
AA seq 252 aa AA seqDB search
MEIDPLLQLVTYLYRISFFIGFLSVIVAKLYLPDFLEYGKTLKDHDEPQNKTILQKIIHF
TVPKAYFSHFYYLSSVLSLVTFCYYPSYPIVWMLLFHSLRRLYETLYTSKYSAKSRMNWS
HYVVGIWFYSTLHIILGIKLHYQEIPRYPRDTFTFLIFFLASWDQYKNHEVLANLVKYSL
PKERLFKLVSCPHYLDELIIYGSFIAFNNEFCWLFVWVFVSLGISALETKAFYQLKFKDE
VVPKYAMVPFIL
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggaaattgatccacttttgcaattggtaacatatctttacaggatatcttttttcata
gggttcctttcagttatagttgctaaattgtacctcccggactttcttgaatacggtaag
acattaaaagatcatgatgaaccgcaaaacaaaactatcctgcaaaaaattattcatttc
acggttccaaaggcatatttctcccatttctattacttgtcgtctgtattgtcattggta
actttttgttattatccatcatacccgattgtttggatgctacttttccattcattaaga
agattatacgaaacattatatacaagtaaatattcggcaaaatcaagaatgaattggtct
cattatgttgtagggatctggttctattctactctgcacataatactgggtatcaaactg
cattatcaggagataccaagatatccaagggatacatttacgtttctaatcttctttcta
gcatcctgggatcaatataagaatcatgaagtactagctaatttggtcaaatattcgtta
ccaaaggaaaggttattcaaactggtaagttgtcctcattacctggatgaacttataata
tatgggtcattcattgcattcaacaatgaattttgctggctattcgtttgggtttttgtg
agtttaggaatttctgccttagagacgaaagcgttttaccaacttaaatttaaagacgaa
gtagtcccgaaatatgccatggtcccatttatactatga

DBGET integrated database retrieval system