KEGG   Naumovozyma dairenensis: NDAI_0A03680Help
Entry
NDAI_0A03680      CDS       T02234                                 

Gene name
NDAI0A03680
Definition
hypothetical protein
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
ndi  Naumovozyma dairenensis
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    NDAI_0A03680 (NDAI0A03680)
Enzymes [BR:ndi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     NDAI_0A03680 (NDAI0A03680)
Peptidases [BR:ndi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   NDAI_0A03680 (NDAI0A03680)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:837931..841281
Genome map
AA seq 1116 aa AA seqDB search
MVDNTTSTNMTATSVTKITDNMSPSINDSKNKNKNNNNRHPNNSCSTISHLTEVAESFIS
NDKERKKFFVDMESSLQKSIDLLQSYKNITKIIKQNNINNNIDNNTTTNNTIIKNYEKAF
IYFKIIHILVLNKIPNFDQFKLIKETKHNNIQNTETTTKKLKKNERINRKYMILLVKTLV
NDEMFPKIKSFIKEHSSLPSSQRRDVQTNGKNTEPSLPDGSLISPQHLQELSRSNDDDDI
LLIDVRPRLNFVENHIDFPNIICIEPISFKPSYTDQDIQQKSLITSPDNEIKLFEMRNQF
KFIILYTSDNNDESHLLSLLKILLTHSFAKPFDRSLTKFYILKGGILNWNGPTTSSGNNI
INQQNDKPSKKLEEKKIQDRKNDNNNNNNTNDNMEDSIYIDGNTSGLSLQHFPKMSPSIT
ASMDLSMQEMMSSPTSSSPLSPLMNNFNQQQPRQFHFQQQSPLKRTSSLKNFLSNFTQNS
NNNSTSNTYIKQQQQQQQLQQQTSILTSSFNSSNNNNNSTTSNKNCLPSFIYPIKNTRQS
SLSNSSSPSHSNSALSLSLISPRSTYKSSSPIPSNLAKYQYLQSSSASSDSSQSEPSLVP
TTAPYPETPTLLTGNEIFDNDAYHNNVITPIRNRAKIVSLSRSLSTNSHISAPSTARSVS
SLSTSRPQSNNIYQNNHNNVRTSFSGTRLSSDYSIPNITTYNDEREKSPYNIQKLQIQNT
AGSNDLIPHHHNNVTTHEKEYDLDFIIGLQNMGNSCYLNCIIQCLLGTHELTKIFLNYSF
ERYINLNSKLGSKGVLAKNLSKLIHLMYNHSTLKNNGDKTKKKSGNNFIKPIQFRMACGS
INNLFKNCSQQDCQEFCQFLLDALHEDLNQCGSNPPLKELSTKAESMREKLSLRIASSIE
WERYLTTDFSVIVDLFQGQYASRLQCKTCIHTSTTYQPFSVLSVPIPKKKNLNLLDCFKD
FTKIENLEVDEQWFCPNCKSKQPSTKKLTITRLPRNLIIHLKRFDNNLNKNNNLIDYPFI
LDLTQFWADDFDGELPPGVTDELPKRGQIPPFKYRLYGAALHFGSLYGGHYTAFVNKGIR
NGWYYFDDTNYRPIKNEREPISSNAYVLFYHRIYGV
NT seq 3351 nt NT seq  +upstreamnt  +downstreamnt
atggttgataatacgactagcacaaatatgactgctacatctgtcacaaaaataacagat
aatatgtcaccatctatcaatgatagcaagaataagaacaaaaacaacaataacagacac
cctaataattcatgttccactatatctcatttgacggaagtggcagaatcattcatatca
aatgataaagaaagaaaaaaattctttgtagatatggaatcatcattacagaaatcgatt
gaccttttacaatcttataaaaatattactaaaattataaaacaaaataatatcaataat
aatatcgacaataatactactactaataacactataattaaaaactatgaaaaggcattt
atttatttcaaaatcattcacatactagtattaaataaaatcccaaattttgatcaattt
aaattgattaaagaaacgaaacataataatattcaaaatactgaaaccactacaaaaaaa
ttaaaaaaaaatgaaagaattaataggaaatatatgatactactagtaaaaactttagtt
aatgatgaaatgttccccaaaatcaaatcattcatcaaagagcattcttctttaccatct
tcacaaagaagggacgtccaaactaatggtaaaaatacagaaccatctttacctgatggt
tccttaatatctcctcaacatttacaggaattatccagaagtaatgacgatgatgacatt
ttactgatagatgtacgaccaagactaaattttgtggaaaatcatattgatttcccaaat
attatatgtatagaaccaatatcatttaaaccttcatacacagatcaagatattcaacaa
aaatcgttaattacctcgccagataatgaaattaaactattcgaaatgagaaatcaattc
aaatttatcatattgtatacatcagataataatgatgaatcccatttattatctttatta
aagatattattgactcattcatttgcaaaaccatttgatcgttcattgactaaattttat
atattaaaaggtggtatattaaattggaatggtccaacgacttcatccgggaataatatt
ataaaccagcaaaatgataaaccttctaagaaattggaagaaaaaaaaatacaagatcga
aagaatgacaacaacaacaacaacaacaccaacgataatatggaagatagcatatatatt
gatggtaatacttcaggtctaagcttacaacatttccctaaaatgtctccaagtataacc
gcttcaatggatttatcaatgcaagaaatgatgtcctctcccacctcatcatctccgctg
tctcccttgatgaataattttaatcaacaacaaccacgacaattccatttccaacaacaa
tctccattaaaaagaacatctagtttgaagaactttctctcaaacttcactcaaaatagt
aacaataatagtacttctaatacctatattaaacaacaacaacaacaacaacaactacag
caacaaacgtctattttaacgtcttcttttaattcaagtaataataataataatagtact
accagcaacaaaaattgtctaccgtcattcatttatccaattaaaaatacaagacaatct
tctctctcaaattcaagttcaccttcgcattcgaattctgcactttctttatcgttaatt
tcaccaagatcaacttataaatcatcatcaccaataccatcaaatttagctaaatatcaa
tatttacaatcatcatcagcttcatcagattcatcccaatcagaaccatcattagttcca
actactgcaccataccctgaaactccaactttactcactggtaatgaaatttttgataat
gatgcataccataataatgttattacaccaatccgtaatagagctaaaatagtttcacta
tcaagatcattatctactaattcacatatatcagcaccctctacagcgagatctgtctcc
tcattatccacatcaagaccacaatcaaataacatatatcaaaataatcataataacgta
agaacttccttttctggtacaagattatcaagtgattactctataccaaatattacaact
tataacgatgaaagggagaaatcaccatataatatccaaaaattacaaattcaaaacaca
gccggtagtaatgacttaataccacaccatcataataacgtaaccactcatgaaaaggaa
tatgatttagatttcatcattgggttacagaatatgggtaattcatgttatttaaattgt
attattcaatgtctcttgggtacacatgaattaactaaaattttcttaaattattcattt
gaaagatatatcaatttgaatagtaaattaggttccaagggtgtcctcgcaaaaaattta
tccaaattaattcatttaatgtataatcattcaactttaaaaaataatggagataaaacc
aaaaaaaaatctggtaataactttattaagccaattcaatttagaatggcatgcggttcc
atcaataatcttttcaaaaattgttcacaacaggattgtcaagaattttgtcaattcctt
ttagatgcattacatgaagatttaaatcaatgtggttctaaccctcctttgaaagaatta
tcaacaaaggcagaatccatgagagaaaaattatcattaagaatcgcttcctctattgaa
tgggaaaggtatctaaccactgattttagtgttatcgtggatcttttccaaggtcagtat
gcatcaagattacaatgtaagacttgtattcatacctctaccacatatcaaccattttct
gtcctttctgttccaattccaaagaagaaaaatttaaatttattggattgctttaaagat
tttaccaagattgaaaatttggaagttgatgaacaatggttttgtcccaattgtaaatcg
aaacaaccatctactaaaaaattaacaataacaagattaccgagaaatttaatcattcat
ttgaaaagatttgataataatctaaataaaaataataatttaattgactacccattcatt
ttagatctaactcaattttgggctgatgattttgatggtgaattaccacctggtgtcact
gacgagttaccaaaaagaggtcaaatcccaccttttaaatatagattatatggtgccgca
ttacattttggtagtctgtacggtggtcattataccgcgtttgttaataagggaattaga
aatggttggtattattttgatgatactaattatcgtccaattaaaaatgaaagggaaccc
atcagttcaaatgcatatgttttattctatcatcgtatttatggcgtttga

DBGET integrated database retrieval system