KEGG   Naumovozyma dairenensis: NDAI_0A05120Help
Entry
NDAI_0A05120      CDS       T02234                                 

Gene name
NDAI0A05120
Definition
hypothetical protein
Orthology
K11482  
histone deacetylase HOS1 [EC:3.5.1.98]
Organism
ndi  Naumovozyma dairenensis
Brite
Enzymes [BR:ndi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     NDAI_0A05120 (NDAI0A05120)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1164314..1165840
Genome map
AA seq 508 aa AA seqDB search
MTKLIISSSLFQSQISDLLPCNNFKKSQLTYSLLNAMSLLECFDHVITNPYCSQEEMMKF
HSKEYINTIMNPRYNNIMPYDEGNESKWNELNEMAKQWYDLNNIEAPEGRSHSRLALYER
FKELSVETNRPSHEVSIPTSKKRSAWEALLDESNSTTEEPVNKRAEKENSNDNEKEMIRE
KLKGYNLEGDCPIFSYLPVYCQVIVGATLSLAKHITAVANERTIAVNWDGGRHHALRNKA
SGFCYINDIVLLIQQLRSNGYKRITYIDFDLHHGDGVQRSFQYSTSVQTISAHMFEPGFF
PCTGSLKESKMGKNIVNIPLLHGVDDMLMNEIVEKVMIPCVKRYDPEILVIQCGGDGLIG
DGYAEWQLTIHGLVNNILKLLRIFPGCPVVLLGGGGYNETVMSRFYTYLTWKIVDEYSNK
KSLKKPFQAKEERIHDKDRSIKGYQLDDRHTDDILITDHELIEAYREEHYKFWIYEQEGS
SKRKNLRNDNGETSEVIKKLRNFYSLDD
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaattaataatttcctcatctctcttccaatcacaaatttcagatttactacca
tgtaacaacttcaaaaaatcacaattgacctattctttattaaatgcaatgagtttatta
gaatgttttgatcatgtcataacaaatccatattgttctcaagaagaaatgatgaaattt
cacagtaaagaatatatcaacaccataatgaatccacgatataacaatattatgccatat
gatgaaggcaatgaatccaaatggaatgaattgaatgagatggcaaagcaatggtatgat
ttgaataatattgaagctccagaaggaagatcccactcgaggctagctctctatgagcgg
ttcaaggaactttcagtcgaaacgaacagaccatcacatgaagtttctataccgacaagt
aagaaacgatcagcttgggaagctcttttagatgagagtaatagtacaactgaagagcct
gttaataaaagagcagaaaaagagaacagtaatgataatgaaaaagaaatgattcgggaa
aaacttaaaggttataatttggaaggtgattgccctatattttcttacctaccagtatat
tgtcaagtaatagtaggagcaactctatcattggctaaacatatcactgcagtagctaat
gaaagaacaattgcagttaattgggatggtggaaggcatcatgctttgagaaataaagca
agcggattttgctatatcaatgatattgtgttattaattcaacaattaaggagcaatggg
tacaaaaggataacgtatattgattttgatctacatcatggtgatggtgtccaaaggtcc
ttccaatattccacaagtgttcaaaccatctcagcccatatgtttgaacctgggtttttc
ccatgtactggatcattaaaggaatctaaaatgggtaaaaatatcgttaatataccatta
cttcatggcgttgatgatatgttaatgaacgagatagtggaaaaagtcatgataccttgc
gtgaaaaggtatgatcctgaaatattggtgatacaatgtggtggggatggtttaattgga
gatgggtatgctgaatggcaattgacaattcatgggcttgtaaacaatatattaaaactc
ctaaggatctttcctggctgccctgttgtattgttgggaggagggggttataatgagaca
gttatgagtagattttatacatacttgacttggaagattgttgacgagtactctaataag
aaatcacttaagaaaccattccaggcaaaagaagaaagaatacatgacaaagatcgtagt
attaagggataccaacttgatgatagacataccgatgacatactcattacagatcatgaa
cttattgaagcatatagagaagaacattataagttttggatctatgagcaagaaggaagc
tccaaaaggaaaaaccttcgtaatgataatggagaaacaagcgaagttattaaaaaactc
cgaaatttttattcacttgatgattaa

DBGET integrated database retrieval system