KEGG   Naumovozyma dairenensis: NDAI_0A05710Help
Entry
NDAI_0A05710      CDS       T02234                                 

Gene name
NDAI0A05710
Definition
hypothetical protein
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
ndi  Naumovozyma dairenensis
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NDAI_0A05710 (NDAI0A05710)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    NDAI_0A05710 (NDAI0A05710)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NDAI_0A05710 (NDAI0A05710)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NDAI_0A05710 (NDAI0A05710)
Enzymes [BR:ndi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     NDAI_0A05710 (NDAI0A05710)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1292463..1293989
Genome map
AA seq 508 aa AA seqDB search
MLRTILYRSRETYHLFLKRSLMTTKATLKEKNASPVLFTLQDTARVVTLNRPKKLNALNT
EICKNMFQTLNEYVKSDVTNMIILKSSDPGRSFCAGGDVATVATCNLEGQIDKSIELFTA
EYSLNFQLATYPKAIVSIMDGITMGGGVGLSIHTPFRVATENTKWAMPEMDIGFFPDVGT
TFALPRLVTLANSRAQMALYLCLTGDLVTGEDAYLLGLSSHYINSDNLKDLEKRLGELSP
PTHKSLKARERKTMFFDMINATINEFCTNLPKNHTFKYSSEQLQVIEKCFDINQVTSIED
IFKHLSEYTGSNEAREFCNEVSMKLSSKSVRSMQLAIKLIQDNCKDDVGSSLRRDLVTAS
NMCINEDGLTEFSEATRHKLIEKNKAPYPWKKIEPMSSGQLNSLLVPKPRLMLSLWKNSA
DVTWSQYPYHMKYQLPTEEAVKRYIKRNDGMSDNLEESLLTKADVVRYFSGFNELTRNKV
NIAQYCASICDRKCTVDQTNGALKWEDS
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgctaaggaccatcctatatagatcaagggagacatatcacctcttcctcaaacgttca
ctaatgactacaaaagccaccctaaaagagaagaatgcctcccctgttttgttcaccttg
caagatacagcaagagtagttactctaaacaggcccaagaaattgaatgcattaaataca
gaaatatgtaaaaacatgtttcaaactttgaacgaatatgtcaagagtgatgtcacaaat
atgattattctgaaatcctcagatccaggaagatcattctgtgctggcggtgatgttgct
acagtggctacatgtaatctagaaggtcaaatagataaatcgattgaacttttcactgca
gagtactcattaaattttcaattagccacatatcccaaggcaattgtctctattatggac
ggtattacaatgggtggtggcgttggtttatccattcataccccattccgtgtcgctacg
gagaataccaaatgggcaatgcctgagatggacataggctttttcccagatgtcggtaca
acatttgctttaccaaggttagtcactttagctaattcaagagcccaaatggctttatat
ttatgtctgacaggtgatcttgtcacaggcgaagatgcttatttgttaggcttatcatct
cattatattaattctgataatttaaaggatttagagaaaagactaggtgaattatctcct
cctacacataagtcgttgaaagcaagggaaaggaaaactatgtttttcgatatgattaat
gcaactattaatgagttctgtaccaacctacccaagaaccatacattcaaatattcgtca
gaacaactgcaagttatcgagaaatgttttgatattaaccaggtaacttcgattgaagac
attttcaagcatttaagtgaatacactggatcaaacgaagctcgtgaattttgtaacgaa
gtaagtatgaagttatcaagcaaatctgttcgttccatgcagctcgcaataaaactaata
caagataattgcaaagatgatgttgggtcatctttgagaagagatttagtaactgcttca
aatatgtgcattaatgaagacggtttaacagaattttcagaagctacgaggcataaactt
attgagaagaataaggcgccatacccatggaagaaaattgagccaatgtcttctggacaa
ttaaactcgcttctggtacctaagccacgtttaatgttgtcactttggaagaattctgct
gatgtaacatggtcacaatatccgtatcatatgaagtaccaattacctactgaagaagcg
gtgaagcgctatattaaaagaaacgacggtatgtctgataatctcgaagaatctttgctc
actaaggccgatgtagtcagatatttcagtggttttaatgaattaacgagaaataaagta
aacattgcacaatattgtgcttctatttgtgataggaaatgtaccgttgatcaaacgaat
ggggctctaaagtgggaagacagttaa

DBGET integrated database retrieval system