KEGG   Naumovozyma dairenensis: NDAI_0A06620Help
Entry
NDAI_0A06620      CDS       T02234                                 

Gene name
NDAI0A06620
Definition
hypothetical protein
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
ndi  Naumovozyma dairenensis
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    NDAI_0A06620 (NDAI0A06620)
Enzymes [BR:ndi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     NDAI_0A06620 (NDAI0A06620)
Protein kinases [BR:ndi01001]
 Serine/threonine protein kinases: Other group
  TTK family
   NDAI_0A06620 (NDAI0A06620)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1510218..1512461)
Genome map
AA seq 747 aa AA seqDB search
MSKYKYRPRARTHDSEQRSPTYSTDSDDEPLSDPPKLSTFASALFSVKDSSNQLDFSENY
NSTTNGPINKYAGLKNVSANESHNITNNATQFDDHSSISTIFAHTNLPRQPSITTTNNNV
PGDDDNARLAESYNELEMESNLQRIKVLQQSMKEELTSRYVERRNRRFLTSRLTRLGPAK
RASSAVSEKDILRSIDNNTQHLLPEYHTPPLSVLDQKEISTVPESAARGNIDYSSIDFGR
LKPFEYLKKKKLPTSELPSISKAYFQKQKEESLQNTLKKRHRTLNEDPKIGTFNDEGGSS
GNIVSKGTPRIPNLPRRKFSQASARPSAPHNLPPTDKYGPIQYSSRDVLTSLDINNQSPS
KADHKFGYDIQIGKPYTVKTPLNESYKRLSPKKKVEIIEPFIYAQKKKTGKKLSITVNGI
DYEKIELLGRGGSSKVYKVKNDQNKIFALKRVSFDEFDDSSIAGFKGEIELLEKLCKEPR
VVRLFDYQMSSGVLYLIMECGDNDLSQVLNQRMGFPLDMDFLRYHVRELLKCVKAVHDAG
IVHSDLKPANFVFIKGLLKLIDFGIANVIPDHTVNVYRESQIGTPNYMAPETLIATNHSI
EQSDLNKEMSKWKVGKPSDVWSCGCIIYQMIYGRPPYAGFQGQNRLLAIMNPEVKVIFSE
RTAKDEKIPTSLIDLMKACLLRDPAKRWSIDKLLCSPFFNPIIVTPFFIKDLIKNAVKYG
TDQKTVTDAKIEELSNDVLERLNDFKM
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaatataaataccgtcctagagccaggactcacgattcggaacagagatcgcct
acctacagtaccgattccgacgatgagccgctatccgatccaccgaaattgagtaccttt
gcttcagctctattttctgttaaggactcttcgaatcaattggacttctctgaaaactat
aatagtacaactaatggacctattaacaaatatgccggactgaaaaatgtgtctgctaat
gaatcccataatataactaacaatgccactcaatttgatgatcactcatctatttccacc
atatttgcccatacaaatcttccaagacaacctagtataacaacaaccaataacaatgta
ccaggtgatgatgataacgctagactggctgaaagttacaatgaattagagatggagagt
aatttacaaaggattaaagttttacaacaatcaatgaaagaggaattaacatcgagatat
gttgaaaggaggaatagacgattcttgacaagtaggcttaccaggctgggtccagcgaag
agagcctcatctgcagtatctgagaaagatatattgagaagtatcgataataacacacaa
cacttacttcctgaataccatactccgccattgtcagtgctagatcaaaaagaaatttca
acggttcctgaatccgctgctcgtggcaacatagattactcatccatagattttggaaga
cttaagccgtttgaatacctcaaaaaaaagaaattgccgacttctgagctgccgagcatt
tcaaaagcttattttcagaaacagaaagaggaaagtttgcagaatacattgaaaaaacgg
caccggaccttgaatgaagatccaaaaattggcacatttaacgatgaaggggggagctca
ggaaatatagtaagtaagggaacgccgagaattccaaatctacctagaagaaaattttca
caagcctcggcgagaccttctgctcctcataatttgcctccaacagataaatacggacct
atacagtactcttctagagatgtcttaacaagtctcgatatcaataaccagtccccatca
aaagctgaccataaatttggatatgacatacagattggtaagccatatacagtcaaaacg
cctctgaatgaaagttacaaacgattgtcacccaagaagaaagtagaaattattgaacct
ttcatttacgcacagaagaaaaagacaggtaaaaagctaagtattacagtaaacggaata
gactacgaaaaaatagaacttctaggtagaggtggttcctcaaaggtttacaaagtaaaa
aatgatcaaaataagatattcgcgcttaaaagagtttctttcgatgaatttgatgacagt
agtatagccggatttaaaggggagattgaattacttgaaaagctgtgtaaggaacctaga
gtcgtgagattatttgattaccaaatgagtagtggcgttttgtatttaatcatggagtgc
ggagacaatgacttatcacaggtgctgaatcaaaggatggggtttccattagatatggac
tttttaaggtatcatgtccgggagctactaaaatgtgtcaaagctgtacatgatgcaggt
atcgttcattctgatttgaaacccgcaaatttcgttttcattaaaggactactgaaattg
attgattttggtattgcaaatgtaattcctgatcacacggtgaacgtataccgagaatca
caaattggtactccaaattatatggctcccgaaactctcattgcaacaaatcactcaatt
gaacaatctgatttaaataaagaaatgagtaaatggaaagtcggcaaaccttcggatgtg
tggtcttgcggctgtataatctaccagatgatatatggtagaccaccttatgctggtttt
caaggccagaatagattactggctattatgaacccagaagtcaaggtaatcttttcagaa
agaaccgcaaaagatgaaaaaataccgacatcattaattgatttaatgaaggcctgctta
cttagggacccagccaaaaggtggtctattgataaactcttatgtagtccttttttcaat
ccaataattgtgactccatttttcatcaaggatttaattaagaacgcagtcaaatatgga
acagaccaaaaaactgttacagacgcaaaaattgaagaactctctaacgatgtgcttgag
cggctaaacgattttaaaatgtaa

DBGET integrated database retrieval system