KEGG   Naumovozyma dairenensis: NDAI_0A07410Help
Entry
NDAI_0A07410      CDS       T02234                                 

Gene name
NDAI0A07410
Definition
hypothetical protein
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
ndi  Naumovozyma dairenensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1691853..1694285)
Genome map
AA seq 810 aa AA seqDB search
MSFEEIFKSLSVPTVIAKDECIYCFESLYNNNPEKETRHSLNICLSCFQAVCKKHTGLHH
KVTEQNCEFSHKHYLNLAKISREENDSKNSITGPSQEKNKKIKLQIVDKSEDELYDTNWS
TVEVKVLGDGSLSQDTINKGTFRDGKLSPIEGDNINEKIPQIINAKSKVLVDEKQAWELQ
MKSCQHTHNLEATASTISIPESSLNLEKCHDCDLPSNLWLCLHCGNVGCGRNQVGIDGHS
HALAHFNTNKEHSLAIKLGSLSTLSNDLYCYSCDDEVKFGTPEFLSNYLSKNFKININSN
AFGNEKSLIELQIEQNMNWDFKMVDAQGRSLLRLSPSKGLGCGLINLGNSCYLNSVMQCL
LNGGVPNWSDKLGNIIGHDFPKDVIYPTGNLRCQMIKLLNAFKLNPEDYEEGIRPRSFKE
CVGKHNAEFKTNNQQDSMEFLTFVTEELEKGLFPKIQDASINPNNLLKFIMEDKLQCVEC
KNVKYTYQPNECIQLPLKEGNDLVGTTTQNLMELITDYFQGEEIEFSCPTCKRMTKAVKK
QSFKTFPNTLIINPLRIKLDKWVPVKTSDSLVIPDLDDANCEFLDIANFQSKGFDAEIEI
LFPETDQGTQFVPDENSMAQLQEMGFTPNAIKRSLYETGNKDTEVAMNWLFQHIDDPDLN
SEFVAPSTSKSKTAEVDQSSLQTMLAMGLDAKLSRKALTIYSGDVAASTEWVFNNLDDDG
ELESVHEEVEERTEGGSEPGNLDNKPYKLTAVICHKGTSVHSGHYVAFIRKLIDNERKWV
LYNDEKIVISENMDEIKRNGYIYIYSRDNL
NT seq 2433 nt NT seq  +upstreamnt  +downstreamnt
atgtcctttgaagaaattttcaaatcgttaagtgttccaacagtaattgcaaaagatgaa
tgtatctattgttttgaatcgttatataacaataatccagagaaggagacccgtcacagt
ttgaatatatgcctatcttgtttccaagctgtttgcaaaaagcacactggtttgcatcat
aaagttactgaacaaaattgtgagttctctcataaacactacttgaatttggcaaaaatt
tctagggaagaaaatgacagtaaaaatagcattacaggtccatcccaagagaagaataag
aagataaaattacagattgttgataaaagtgaggatgaattatacgatactaattggtcc
accgtggaagttaaggttttaggcgacgggtcattatcccaagataccatcaataaaggt
acatttagagacggcaaattatcaccgattgaaggagataatatcaatgaaaaaatacct
cagatcattaatgcgaaatcaaaagttctagttgatgaaaagcaggcatgggaattgcaa
atgaagtcttgccaacacacacacaatttagaggcgactgcatcgaccatttcgattcct
gaatcttcattaaatttggaaaagtgtcatgactgtgatttgccttccaatttatggcta
tgtttacattgtggtaatgtggggtgcggtagaaaccaagttggtattgatggacattct
catgcgttagcccatttcaacaccaataaagaacattcgttagctataaaattaggttct
ttgtccactttatccaatgatttatattgctattcgtgtgacgacgaagtaaagtttgga
actccagagttcctatccaattatttgagtaaaaactttaaaattaatataaatagtaat
gcgtttggtaatgaaaaatctttaattgagctgcagattgaacaaaatatgaattgggat
ttcaaaatggtagacgcacagggcagaagcctcttaagattgtccccaagtaaaggttta
ggttgtgggttgattaatttaggaaattcctgttatttgaattcagttatgcaatgctta
ttgaatggcggtgttccaaattggtcagacaaactgggtaatatcattgggcatgatttc
ccgaaggatgttatctatccaacaggaaacttgagatgtcaaatgattaaacttttgaat
gccttcaagttgaatcctgaagactacgaggaaggtataagaccaagatcatttaaagaa
tgtgtcgggaagcataatgcagaatttaaaacaaataatcagcaagattctatggaattt
ttaacatttgttactgaggaactagagaaaggcctctttcctaagattcaagacgctagt
ataaatcccaataatttattgaaatttatcatggaggataaattacaatgtgttgaatgt
aaaaacgttaaatacacatatcaaccgaacgaatgcattcaattaccattgaaagaaggt
aacgatctcgtaggtactaccactcaaaatttgatggaattgattactgattatttccaa
ggcgaagagattgaattcagttgtcccacatgtaagaggatgactaaggcagttaaaaag
caaagtttcaagacgttcccaaatactcttatcataaacccattgagaattaaattagac
aaatgggtaccagttaaaacgtcagacagtttagtcatccctgatttagatgacgcaaat
tgtgagttcttagatatagctaacttccaatctaagggatttgatgcagaaatagagata
ttattccctgaaacggatcaaggaacacagtttgtcccagacgagaattcaatggcccaa
ttacaggaaatgggtttcactccgaacgctatcaaaagatcattgtacgaaaccgggaat
aaagacacagaagtagcaatgaattggttatttcagcacattgatgatccggatcttaat
tctgaatttgttgccccatcaacatcaaaatctaaaactgcagaagttgatcaaagttcg
ttacagacgatgttagctatgggacttgatgcgaaattatcaagaaaggcattaactatc
tattctggagatgttgcagctagtactgaatgggttttcaataatttagatgatgatggt
gaattagagagtgttcatgaagaggtcgaagaaagaactgaaggtggctccgaaccagga
aatctcgacaacaaaccttacaagcttactgccgttatttgccataaaggtacttcagta
cattcagggcattatgttgctttcataagaaaactaattgataatgaaaggaagtgggtc
ctttacaatgatgagaaaattgtcataagtgaaaatatggacgaaattaaaaggaatggg
tacatttacatttattctagagataacttgtag

DBGET integrated database retrieval system