KEGG   Naumovozyma dairenensis: NDAI_0A07510Help
Entry
NDAI_0A07510      CDS       T02234                                 

Gene name
NDAI0A07510
Definition
hypothetical protein
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
ndi  Naumovozyma dairenensis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    NDAI_0A07510 (NDAI0A07510)
Enzymes [BR:ndi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     NDAI_0A07510 (NDAI0A07510)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1718630..1721230
Genome map
AA seq 866 aa AA seqDB search
MMNLPKYENKPFKPPRKLTLTGNAKTSTVKRSISRTQITASPLTKRTKTCATLTETPSAL
PNQSDNNKLFTIMYRKPSMKKHKTWDKDGYAELKQSGILIFYNESGARIGRVSKIEPLLE
TIHKAGSWEVQLDYELTDTKEITKIRTLLKNNFESASITPPSTASSTASNVLPSTSKAQI
PITQLFTVQTVKKFKTVLPKPNEHTSLSTTVNQDTNSTRRNYLPVFVQTKIKNPLVMNKS
IDADVDVIVDPLISKFLRKHQREGVKFIYDCINGLSQVEASTAVVDPTQQSMILEKNSDI
NGCLLADEMGLGKTLMTIAVIWTLYKQTPLVKNIPCSQSGVPLSGLCKKFLIICPVTLIG
NWKREFKKWLNLNRIGILTLNSNNTPEMDRNAVKNFLKVQRTYQVLIMGYEKVLSVSAEL
TNQKNLIDMLVCDEGHRLKSGTSKVLQVLKNLDVKRKILLSGTPIQNDLNEFYTIIDFIN
PGILGSFPYFKKRYMVPITRARDTSNRYNEEILELGEERSREMIEITKQFTLRRTNSILT
EYLPPRTDIILFCKPTETQLQAFDNAIRGAKLDFNTASFNSTLGLITLLKKICNSPSLIK
NDSYFTSKIDHSQYQRANFNVLNSGKLMVLMSLLKHLRTNCPEEKIVIVSNYTQTLDIIE
NLLLSEQMIFCRLDGSTLPKQRDSIVMSFNRNPSTFAFLLSAKSGGVGLNLVGASRLVLF
DNDWNPSIDLQAMSRIHRDGQKRPCYIYRLITTGCIDEKILQRQLMKHNLSQKFLDSSIE
NTNVNDDLFDKQDLRDLFSINHHTKSNTHDLICTCDGLGDEIQYDTEAPDSVPPNGKKCT
TWNQRVNNYQRRSKKWTSLHKKKRQL
NT seq 2601 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatttacctaaatacgagaataaacctttcaaaccaccaagaaagttgacatta
actggcaatgcaaagacatcaacagtaaaaagatcaatcagtagaactcaaattactgcg
tccccattgactaagaggaccaaaacttgtgctaccctaacagagactccctctgctctc
ccaaaccaatcagacaataataaactgttcaccatcatgtatagaaaaccatcgatgaaa
aaacataaaacatgggataaggatggttatgcagagttgaaacaatctggtatactgatt
ttctataatgaatcaggtgctagaattgggagggttagtaaaatagagcctcttctggaa
acgatacataaggcaggatcatgggaggttcaattagattatgagttgactgacacaaag
gaaattacgaaaatacgtactttattaaagaataatttcgaatctgcttcgattaccccc
ccttctacagcgagctcaacagcatctaatgtgttaccttccacatcgaaggcgcaaatc
ccaataacacaactatttacggtccaaactgtaaagaaatttaagacagttcttcctaaa
ccaaatgaacatacatcgttatcaaccacagtaaatcaggataccaattcgacgaggaga
aactatttacctgtgttcgttcaaacaaaaatcaagaatccactcgtaatgaataaatca
atcgacgcagatgtggacgtcattgtagatccattaataagtaaatttttacggaaacat
caaagggaaggtgtaaaatttatatatgattgtatcaatgggttatcccaagtagaagcc
tctaccgctgtggttgatccgacacaacaaagtatgattttagaaaagaattccgatatc
aatggttgtctattagctgatgaaatgggactaggtaaaacgttgatgacgatagctgta
atatggacattatataaacagacgccacttgttaaaaatatcccatgttcacaatccgga
gttccattgagtggtctctgtaagaaattcttgatcatctgtccagttactttgattgga
aattggaaaagagaatttaaaaaatggctgaatttaaatcgaattggtattcttacctta
aactcaaataacactccagagatggatagaaatgccgtaaaaaactttcttaaagttcaa
agaacttaccaagtacttattatgggctatgaaaaagtacttagtgtttcagcggaatta
accaatcaaaaaaatctcattgacatgttggtttgtgatgaggggcatcgattaaagagt
ggaacatcaaaagtacttcaagtgctaaagaacctagatgtgaaacgcaaaatcctactt
tctgggacaccaattcaaaatgatcttaatgaattttatacaataattgactttataaac
ccgggcatattaggaagctttccttacttcaagaaaaggtacatggtaccaataacaagg
gcaagagatacttcaaatagatacaacgaggaaattttagaactcggagaagaaaggtcg
agggaaatgatcgagataacaaagcagttcaccctacgaaggacaaattctatcttaaca
gagtatcttccacccaggacagatattatattattctgcaaaccgacggaaactcaattg
caagcttttgacaatgcaatacggggtgcgaaactagatttcaatactgcgtcattcaac
tctactctaggattaataactcttctcaaaaaaatatgcaattcaccttccttgataaag
aatgatagttacttcacatcaaaaatagaccattctcagtatcaacgagcaaattttaat
gttttaaactctggaaagctaatggtattaatgtcattattgaagcatcttagaactaat
tgtcccgaagagaaaattgttattgtatccaactatacgcaaacattagacatcattgaa
aatttacttctgtcagagcaaatgatattttgtagattagatgggtcaactttaccgaaa
caacgagactcaatcgttatgtctttcaataggaatccgtccacttttgcatttctccta
agtgcgaaatctggtggagtaggtctaaatttagttggcgcatccagattagttcttttc
gataatgattggaacccatctattgatttacaagcaatgtctaggattcacagagatgga
caaaagaggccatgctatatttatagacttatcactaccgggtgcatcgatgaaaaaatc
ctacagagacagttaatgaagcataaccttagccaaaagttccttgattcctcgattgag
aataccaatgttaacgacgatttatttgataaacaggatttaagagatttattttcaatt
aaccatcacacaaaaagtaatacgcatgatttaatatgtacttgtgacgggctgggagat
gagatacaatatgatactgaagcaccggactccgttcctcctaacggaaagaaatgcacc
acttggaaccaacgcgttaacaattatcagaggagatcgaaaaagtggacaagcttacac
aagaaaaaaaggcaactttaa

DBGET integrated database retrieval system