KEGG   Naumovozyma dairenensis: NDAI_0B00210Help
Entry
NDAI_0B00210      CDS       T02234                                 

Gene name
NDAI0B00210
Definition
(RefSeq) hypothetical protein
Organism
ndi  Naumovozyma dairenensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
2:27983..29185
Genome map
AA seq 400 aa AA seqDB search
MSQTDDFISMKEIGQAINDSQRQEQLPQQQQHQQEHDQGQQELQQQQPPAPPIQPEHHQH
PHPNTQGPTKVRKNLEGRKTSGKYTLNDFQILRTLGTGSFGRVHLIRSIHNGRFYALKVL
KKHTIVKLKQVEHTNDERLMLSVVNHPFLVRMWGTFQDCEQIFMIMDYIEGGELFSLLRK
SQRFPNPVAKFYAAEVCLALDYLHSLDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDI
TYTLCGTLDYIAPEVVSTKPYNKSVDWWSFGILIYEMLAGYTPFYDSNTMKTYENILNSK
LKFPEFFHEDVRDLLSKLITKDLSERLGNLQNGTDDVKSHPWFSEVVWDKLLSRNIETPY
EPPIQQGQGDTSQFDRYPEEEINYGIRGVEDPYHDLFKAF
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaaactgacgatttcatctcaatgaaggaaattggtcaagcaatcaacgactct
caaagacaagagcaattaccgcagcagcagcaacaccaacaagaacatgaccaaggtcaa
caggaactacagcagcaacaacctcctgcccctcctatacaacctgaacatcatcaacat
ccacatccaaatactcagggacctactaaagtacgtaaaaatttagaaggtagaaaaact
tctggcaaatatactttgaatgatttccaaattttaagaactttagggaccgggtccttt
ggtagagttcatttaatcagatctattcataacggtagattctacgctttaaaagtatta
aagaaacatactattgttaaactgaaacaagtagagcatacgaatgatgaaagattaatg
ctatcagtggtgaatcatccatttctagttagaatgtgggggacgtttcaagattgtgaa
cagattttcatgattatggattatattgaaggcggtgaattattctcactattaagaaaa
tctcaaagattcccaaatcctgtagctaaattctatgctgctgaagtctgtctggctttg
gattaccttcatagtctggatatcatttatagagatttaaagccagagaatattttgcta
gataagaatggacatattaagataactgattttgggttcgctaaatatgtccctgatatt
acttatacattatgtggcacactagattatattgcacctgaagtagtcagtacgaaaccg
tataataaatctgtcgattggtggagttttgggatattgatatatgaaatgttagcaggg
tatacaccattctatgattctaatacaatgaaaacatatgaaaatatcttgaatagtaaa
ttgaaatttcctgaatttttccacgaagatgtaagggatctattatctaaactaatcacc
aaggatttaagtgagagattgggtaacctacaaaacggtacagatgatgtgaaaagccat
ccttggtttagtgaagttgtttgggacaaattgctgtcaagaaatattgaaacaccttat
gaaccaccgatccagcaaggtcaaggtgatacctctcaattcgacagatatcctgaagaa
gaaatcaactatggtattcgtggagtagaagatccatatcatgatttatttaaagcattc
taa

DBGET integrated database retrieval system