KEGG   Naumovozyma dairenensis: NDAI_0B00800Help
Entry
NDAI_0B00800      CDS       T02234                                 

Gene name
NDAI0B00800
Definition
hypothetical protein
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ndi  Naumovozyma dairenensis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NDAI_0B00800 (NDAI0B00800)
Enzymes [BR:ndi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     NDAI_0B00800 (NDAI0B00800)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:185488..186228
Genome map
AA seq 246 aa AA seqDB search
MNNRNDLMGINRNETGTPLNMKASSPFTLNPPVDSDGFSWPSVGTKQRSIESPEEEQQRI
ERIADAVKVILNEVGEDINREGLLATPERYAKAMLFFTKGYQTNIMDDVINNAVFEEDHD
EMVIVRDIEIHSLCEHHLVPFFGKVHIAYIPNKKVIGLSKLARLAEMYARRLQVQERLTK
QIALALSEILKPLGVAVVIEASHMCMVSRGVQKTGSSTMTSCMLGCFRDQHKTREEFLTL
LNKSNR
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaccgtaatgatttaatgggaataaatagaaatgaaactgggacgccattgaac
atgaaggcgtcgtcaccatttacattgaatccacctgtagattcagatggtttctcatgg
cccagcgtggggaccaaacaacgttcaattgagtcccctgaagaagaacaacaacgaatt
gaacgtattgcagacgctgtcaaagttatattgaatgaagttggtgaagatatcaataga
gagggtctcttagcgacacctgaacgttatgccaaggcaatgcttttctttacgaaaggg
taccaaacaaatatcatggatgatgtgattaataatgctgtctttgaagaagatcatgat
gaaatggttatcgtgagagatattgaaattcattcattatgtgaacatcatttagtacca
ttttttgggaaagttcatattgcatatattccaaataaaaaagttattggattaagtaaa
ttggctagattggcagaaatgtatgcgagaaggttacaagttcaagaacgattaacgaaa
caaattgcactcgctttaagtgaaattttgaaaccattgggtgttgctgtggtcattgaa
gcatctcatatgtgtatggtatcaagaggtgttcaaaagacagggtcctctactatgact
tcatgtatgcttggttgtttcagagatcaacataagactagagaagaatttttaacttta
ttaaataaaagcaatcgttaa

DBGET integrated database retrieval system