KEGG   Naumovozyma dairenensis: NDAI_0B01070Help
Entry
NDAI_0B01070      CDS       T02234                                 

Gene name
NDAI0B01070
Definition
hypothetical protein
Orthology
K13996  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
ndi  Naumovozyma dairenensis
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    NDAI_0B01070 (NDAI0B01070)
Enzymes [BR:ndi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     NDAI_0B01070 (NDAI0B01070)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:252666..254753
Genome map
AA seq 695 aa AA seqDB search
MTCLKHIQLLLCFSITLILQGTQVAASDDKHPEGFPKPLTGSTFDNEMKNGLHIVEFFSP
YCHHCKSLAPIWEKTWESFHEEGSKLNITLSQVNCVEDGDLCSKENIEYFPYIKLYGPSG
FIKNYDGARKEEAFIKFARKEALDPLNVDISHVESQSILLSKLEFAKYLAGKGKDPILIS
FWPTNEMKNSDDRIAFENCADCTTFQRAWKMLSKNLLADGVLTGHMNCEENPLICNELGF
GELSKIKNHRSDRVPRVALVLPNRATNNLFIFKGDIASPLSQYQDFATRTYANSIAPEIN
KDDVISIINTEVMNMEGRPGPKMHLVFNYDAKITFSEDFDILEYLIEPLSKIPNLYLYKS
KEDLKSLTHTSFEEMYKMINYNETEPEKVLDENQFALNTITQFPTFFLFKDGDKIPHVFP
GYSTTEMRNVETIMNWVKEFAIPMITEVNEDNFWDLMNSQHERYSDIAILLIDSARMKES
VNSVNNLVTGNYDYEHVRMSQMFQWIMGERNDKLEYVQKLKNKKAQSAKIVAALRKEIPH
KDDRSVILTYLDIYKNKNTLSKLGFDCTVPQKSGNVIIVDRSKSSFFEVNRDGKPLTDNP
YDIREILTTLNFPQSSFSKFVNHGRRINSPYSRQLRHLDFIHSYGIFGYIMLAVVVTMIY
KSKSLVHIYRSKRKYQAKRDTRGLLGWSDKKEFQD
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgacttgcctaaaacatatacaattgctactctgtttctccatcacgctaattcttcaa
ggaactcaagtggcggcatcagatgacaaacatccagagggtttcccgaaaccactaact
ggttctacattcgataatgaaatgaaaaacgggttacatatagtcgaatttttcagtcca
tattgtcatcattgtaaatcattagcgcctatttgggaaaagacatgggaatcattccat
gaagaaggttcaaagctgaatattactctttcacaagtgaattgtgtggaggatggtgat
ttatgttccaaggaaaatattgaatatttcccatatattaaactgtatggtccatctggg
ttcattaaaaactatgatggtgcaagaaaagaagaagcatttattaagtttgctagaaaa
gaagcattggatcctttgaatgttgatattagtcatgttgaaagccaaagtatactacta
tcaaagcttgaatttgcaaagtatttggctggcaaagggaaagatccaatcttgatttcg
ttttggccaacaaatgagatgaaaaattcagatgataggatagcttttgaaaactgtgct
gattgtactacattccaaagagcttggaagatgttatctaagaatttacttgctgatggt
gtcttgacaggtcatatgaattgtgaagaaaatccccttatttgtaatgagttaggtttt
ggtgaattgtcaaagattaaaaaccatcgaagtgatagggtacctagagttgcactggtt
cttcctaacagagcaacaaataatttgtttatattcaaaggtgatattgcatcacctcta
tcacaatatcaagatttcgccacgagaacttatgctaacagtattgcccctgaaattaac
aaagacgatgtaatatcaatcataaatacagaggttatgaatatggaaggccggccagga
ccaaagatgcacttggtctttaattatgatgcaaagatcactttttcagaagatttcgat
attttagaatatttgattgaaccgctttcaaaaatcccaaacttatatctttataaatca
aaagaagatttgaaatcattgactcatacatcgtttgaagaaatgtacaagatgattaat
tataatgaaactgaaccggaaaaagttttggatgagaatcagtttgccttaaataccatc
actcaatttccaacctttttccttttcaaagatggtgataaaataccacatgtcttccct
ggttattctaccacggaaatgagaaatgtagagacaataatgaactgggttaaagaattt
gcaatcccaatgattactgaagttaatgaggataacttttgggatttaatgaattcgcaa
catgaacgttatagtgacattgccattttactaatagattctgcaagaatgaaggaaagt
gtaaatagtgtgaataacctggttacaggaaattatgattatgagcatgttcgtatgtct
caaatgttccaatggataatgggagaaagaaatgataagttagagtatgtccagaaattg
aagaataagaaagcacaaagtgctaaaatcgtagctgccctacgtaaggagattcctcat
aaagatgataggtctgttattttaacttaccttgatatttacaaaaataaaaacacgtta
tctaaactgggatttgattgtacagtcccacaaaagtcaggaaatgtcattattgtcgac
agatcaaagagttccttttttgaagtcaatcgtgatgggaagcctttaactgacaaccca
tatgatataagagaaatattaactactttaaatttcccacagagttcattttccaagttc
gtaaaccatggcagaagaatcaattctccctattccaggcaactaagacatttggatttc
atacatagctatggcatattcggatatattatgttggcggtggtagtaactatgatatat
aaaagtaagtctttggttcatatctacaggtccaaaagaaagtatcaagctaaaagggat
actcgagggttattaggttggtcagacaagaaagagttccaagattga

  All links  
No link information was found.   
DBGET integrated database retrieval system