KEGG   Naumovozyma dairenensis: NDAI_0B01240Help
Entry
NDAI_0B01240      CDS       T02234                                 

Gene name
NDAI0B01240
Definition
hypothetical protein
Orthology
K08738  
cytochrome c
Organism
ndi  Naumovozyma dairenensis
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    NDAI_0B01240 (NDAI0B01240)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(292907..293245)
Genome map
AA seq 112 aa AA seqDB search
MPAAAEYKPGSEKKGATLFKTRCLQCHTVEEGGPHKVGPNLHGIFGRRSGQAVGYSYTDA
NIKKNVEWNVNNMSEYLTNPKKYIPGTKMAFGGLKKEKDRNDLITYLKKACE
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgccagctgctgcagaatataaacctggatctgaaaagaaaggtgctaccttattcaaa
accagatgtttacaatgtcatacagtagaggaaggtggaccacataaagtgggtccaaat
ctacatgggatctttggccgtcgttcaggtcaagctgtcggctattcatacactgatgct
aatatcaagaagaatgtggaatggaatgtaaataatatgtctgaatatttaactaatcca
aagaagtacattccgggtactaagatggccttcggtgggttaaagaaagaaaaagacaga
aacgatttgatcacatatttgaagaaagcttgcgaataa

DBGET integrated database retrieval system