KEGG   Naumovozyma dairenensis: NDAI_0B01690Help
Entry
NDAI_0B01690      CDS       T02234                                 

Gene name
NDAI0B01690
Definition
hypothetical protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ndi  Naumovozyma dairenensis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NDAI_0B01690 (NDAI0B01690)
   00052 Galactose metabolism
    NDAI_0B01690 (NDAI0B01690)
   00500 Starch and sucrose metabolism
    NDAI_0B01690 (NDAI0B01690)
   00520 Amino sugar and nucleotide sugar metabolism
    NDAI_0B01690 (NDAI0B01690)
Enzymes [BR:ndi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     NDAI_0B01690 (NDAI0B01690)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:402710..404209
Genome map
AA seq 499 aa AA seqDB search
MSGSKRHTKTQSTYAFESNTSNVAASQMRNALNKLADSVKDEQLRFQFENQLDSFFSLFR
RYLVEKSSGSTLEWEKIKSPNPNEVVDYNVISQQPENVTNLSKLAVLKLNGGLGTSMGCV
GPKSVIEVRDGNTFLDLSVRQIEHLNRQYDSDVPLLLMNSFNTDKDTEHLIKKYSANRIR
IRSFNQSKFPRVYKDSMLPVPTTINDPLDAWYPPGHGDLFESLHASGELDALIAQGREIL
FVSNGDNLGATVDLKILNHMLETGAEYIMELTDKTRADVKGGTLINYDGQVRLLEVAQVP
KEHIDEFKNIRKFKNFNTNNLWINLKAIKRLIESSALQMEIIPNGKTIVRNGHEINVLQL
ETACGAAIRHFEGAHGVVVPRSRFLPVKTCSDLLLVKSDLFYLQHGALKLDPTRFGPNPL
IKLGSHFKKVSNFNSRISHIPKIVELDHLTITGNVFLGKDVTLRGTVIIVCSDGQRIDIP
NGSILENVVITGNLQILEH
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggatctaaaagacacacaaagactcaatctacttatgccttcgaaagcaacaca
agtaatgtcgcagcttctcaaatgagaaatgctctaaacaaattggctgattctgtcaaa
gatgaacaattacgtttccaattcgaaaatcaattagattcattcttctccctattcaga
agatatcttgttgaaaaatcttctggttccactttagaatgggaaaagattaaatctcca
aatccaaatgaagtcgtggattataacgttatcagtcaacaaccagaaaacgttactaat
ttatctaaattggctgtcttaaaattaaatggtggtcttgggacatcaatggggtgcgtg
ggtccaaaatctgtcatcgaagttagagatggtaacactttcttagacctttctgtaaga
caaattgaacatttaaatagacaatacgatagtgacgtccccctattattaatgaattca
tttaatacggataaagatactgaacatttaattaaaaaatattctgctaatagaattaga
attagatcttttaatcaatctaaattcccaagagtatataaggattccatgttaccagtg
ccaactactattaatgacccattagatgcttggtacccacctggtcatggtgatcttttc
gaatcattacatgcttctggtgaattagatgctttaattgctcaaggtagagaaatcctt
ttcgtttcaaatggtgataatttaggtgctactgtggatttgaaaatattaaatcatatg
ttagaaactggtgctgaatatattatggaattgaccgataagacaagagcagatgtgaaa
ggtggtactttaattaattatgatggtcaagttagattattagaagttgcacaagttcca
aaggaacatattgatgaatttaaaaatattagaaaatttaaaaattttaatacaaataat
ttatggattaatttaaaggcaattaaaagattaattgaatcaagtgctttacaaatggaa
atcattccaaatggtaagacaattgtaagaaatggtcatgaaattaatgtattacaatta
gaaactgcttgtggtgctgcaattagacattttgaaggtgctcatggtgtagtggttcca
agatcaagattcttaccagtgaaaacttgttcagatttattattagtaaaatctgattta
ttctatttacaacatggtgctttgaaacttgatccaacaagatttggcccaaatccatta
attaaattaggttctcattttaaaaaagtttccaatttcaattcaagaatttctcatatt
ccaaaaattgttgaattagatcatttaaccattacaggtaacgttttcttaggtaaagat
gtcactttaagaggtacagttatcattgtttgttctgatggacaaagaatcgatatccca
aatggttccatattggaaaatgttgtcatcacaggtaatttacaaatattagaacattga

DBGET integrated database retrieval system