KEGG   Naumovozyma dairenensis: NDAI_0B01900Help
Entry
NDAI_0B01900      CDS       T02234                                 

Gene name
NDAI0B01900
Definition
hypothetical protein
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
ndi  Naumovozyma dairenensis
Pathway
mRNA surveillance pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    NDAI_0B01900 (NDAI0B01900)
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    NDAI_0B01900 (NDAI0B01900)
Enzymes [BR:ndi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     NDAI_0B01900 (NDAI0B01900)
Protein phosphatases and associated proteins [BR:ndi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     NDAI_0B01900 (NDAI0B01900)
Transcription machinery [BR:ndi03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     NDAI_0B01900 (NDAI0B01900)
Spliceosome [BR:ndi03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    NDAI_0B01900 (NDAI0B01900)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(join(454169..454933,455502..455678))
Genome map
AA seq 313 aa AA seqDB search
MDQQAVDVDNIIDRLLEVRGSKPGQQVDLEEHEIRYLCSKARSIFIKQPILLELEAPIKI
CGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFIL
RGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCMHGGLSPDLN
SMEQIRRVMRPTDIPDVGLLCDLLWSDPDKDIVGWSENDRGVSFTFGPDVVNRFLQKQDM
ELICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDESLLCSFQILKPAQK
SLPRQQGGGRKKK
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggatcaacaagcagtcgacgtggacaatattattgatagactattagaagttcgaggt
tctaaaccaggtcaacaagttgatttggaagaacatgaaattagatatctatgttccaag
gcaagatctatattcattaaacaaccaattttattagaattagaagcaccaatcaaaatt
tgtggtgatattcatggccaatattatgatttattacgtctttttgaatatggtggtttc
ccacctgaatctaattatttatttttaggtgattacgttgatcgtggtaaacaatcatta
gaaacaatttgtcttttattagcttataagattaaataccctgaaaatttcttcatctta
agaggtaatcatgaatgtgcttccattaatagaatttatgggttttatgatgaatgtaaa
agacgttataacattaaactttggaaaacttttacagattgtttcaattgtttaccaatt
gctgcaatcattgatgaaaaaatcttttgtatgcatggtggcctatcacctgatttaaac
agtatggaacaaattagaagagttatgagaccaactgatattcctgatgtcggcttatta
tgtgatcttttatggtcagatcctgataaggatatcgtaggttggagtgaaaatgataga
ggtgtttcattcacttttggccctgatgtggtaaatagattcttacaaaagcaagatatg
gaattgatttgtagagctcatcaagtcgttgaagatgggtatgaatttttcagtaaaaga
caattagtaacacttttcagtgctccaaattattgtggtgaattcgataacgccggtgct
atgatgagcgttgatgaaagtttattatgttcttttcaaattttaaaacctgcacaaaaa
agtttgccaaggcaacaaggtggtggtagaaagaagaaataa

DBGET integrated database retrieval system