KEGG   Naumovozyma dairenensis: NDAI_0B01990Help
Entry
NDAI_0B01990      CDS       T02234                                 

Gene name
NDAI0B01990
Definition
hypothetical protein
Orthology
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
ndi  Naumovozyma dairenensis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NDAI_0B01990 (NDAI0B01990)
   01210 2-Oxocarboxylic acid metabolism
    NDAI_0B01990 (NDAI0B01990)
   01230 Biosynthesis of amino acids
    NDAI_0B01990 (NDAI0B01990)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NDAI_0B01990 (NDAI0B01990)
Enzymes [BR:ndi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     NDAI_0B01990 (NDAI0B01990)
Amino acid related enzymes [BR:ndi01007]
 Aminotransferase (transaminase)
  Class I
   NDAI_0B01990 (NDAI0B01990)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(493160..494926)
Genome map
AA seq 588 aa AA seqDB search
MSVASIITFRRSTSTAVTTNFANLKQLNKMATCTYSIKANVSNSNSNNIKTINSNQVKKS
PLIIKATTTAIPEYQFFDAKRALMTRSISHHSLKVAKGKDFAPAEQLTLADLNENVLKAK
YAVRGSIPMRAEELKVQLENNPSTLPFSQIVNANIGNPQQLKQKPLSFYRQVLSILQYPD
ILKENEQNLIDAKVYKRDAIDRAKLLLSEIGGSVGAYSASQGVYGIRKTVANFITERDGG
EPAYPEDIFLTVWCFRCCCYLLSILCQGPKTGVLIPIPQYPLYTATLALNNSHALPYYLD
EKSGWSTNPKEIEEVVQDAMERAINPSVLVVINPGNPTGAVLTEESIEHIFEIAAKYGIV
VIADEVYQENIADGVKFYSMKKVLRKLQKSHPGKFDNVQLASLHSTSKGVSGECGQRGGY
MELIGFTHEVRKVILKLASISLCPVVTGQALVDLMVSPPKKGDASYEQDQAERRHIKSEL
SIRASQLYETFVGLEGIECQKPQGAMYLFPKLDLPFKAVQEAQHLEMTPDEFYCKSLLDA
TGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWEAFHKEFYDNYRD
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgagtgttgcctctatcattactttccgtcgttcgacttcaactgctgtaacaacaaac
ttcgcaaatttaaaacaattaaataaaatggctacatgtacttactcaataaaagctaat
gttagtaatagcaatagcaataacattaaaacaattaattcaaatcaagtcaagaaatct
cctctaataataaaagctacaactactgctattccagaatatcaatttttcgatgctaag
agagccttgatgacgagatcgatatctcatcatagtttgaaggtcgctaagggaaaagat
tttgctcctgctgaacaactgactttagcagatttaaatgaaaatgtattgaaggctaaa
tatgctgttcgaggttctatcccaatgagagctgaagaactaaaggttcaactagagaat
aatccttctactttacctttctctcaaatagtgaatgccaatataggtaatcctcaacaa
ctaaaacaaaaacctttaagtttttatagacaagttctatccatattacaatatcctgat
atattaaaggaaaatgaacaaaacttaattgatgcaaaggtctataagagggatgctata
gaccgtgctaaactattgttaagtgaaattggtggttctgtaggggcttattctgcctct
caaggtgtgtatggtattaggaaaactgtcgctaatttcatcacagaaagagatggaggt
gaacctgcttatcctgaagatatttttttaaccgtctggtgcttccgctgctgttgctac
cttttatccattctttgtcaaggtcctaagacaggtgttttgattccaatcccacaatat
ccactatatactgctactttggctctaaacaactcacatgctttgccttattatttagat
gagaaatcgggatggtcaacgaatccaaaagaaatagaagaagttgtccaggatgctatg
gaaagggctatcaacccatctgtccttgttgtaattaacccgggaaatccaactggggcc
gttctaactgaagaatcaattgaacatatctttgaaatcgccgctaaatatggtatcgtt
gtcattgccgatgaagtatatcaagaaaatattgctgatggtgttaaattctattcaatg
aaaaaagttctaagaaaattacaaaaatctcatcctggtaaattcgataatgttcaatta
gcttcattacactcaacctctaaaggtgtttctggtgaatgtggtcaaagaggtggttat
atggaacttattggatttactcatgaagttagaaaagttattttgaaattagcttccatt
tctttatgccctgttgtcactggtcaggctctagttgatttaatggtctctcctccaaag
aaaggtgatgcatcttatgagcaggatcaagccgaaaggagacatattaaatctgaacta
agtatcagagcttctcaactttatgaaacttttgtcggtttagaaggcattgaatgccaa
aaaccacaaggtgctatgtatttattcccaaaattagatttaccgtttaaagctgtacaa
gaagctcaacatttagaaatgacaccggatgaattttattgtaaatcattgctagatgct
accggtatctgtactgtaccaggctcagggttcggtcaagagccaggtacatatcattta
agaacgacattcttggctccaggtacggaatggatcaagaaatgggaagcgttccacaaa
gaattttatgacaactatagggattga

  All links  
No link information was found.   
DBGET integrated database retrieval system