KEGG   Naumovozyma dairenensis: NDAI_0B02180Help
Entry
NDAI_0B02180      CDS       T02234                                 

Gene name
NDAI0B02180
Definition
hypothetical protein
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
ndi  Naumovozyma dairenensis
Brite
Enzymes [BR:ndi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     NDAI_0B02180 (NDAI0B02180)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(539822..541036)
Genome map
AA seq 404 aa AA seqDB search
MELTDFKPSTWISSSKDSLKISLVSKDGAVQFAPIFTYPIFGDAEQIVGYQDLLVHLAFD
SITFRPFLNVKYSTKLDTEDIDDVEGELLKVLPSDKDEVILKDEAKWVDMFEFEQKNSFK
LPEDKYKVNEYEIDKEHFVVYKMKLSDDEKFLKLHRRIQIFSLFFIEAASYIDEEDFNWD
IYWLFNKEKKQCMGYATAYMYWKYLGGKDFDESKEPKHYRAKVSQFLILPPYQGKGHGSK
LYQAIFKNWLSNDLVREFTVEDPSENFDDLRDRNDLNFLYENGFFQELSSKIVNEKDFIS
NEWLLSKQRAYKIEKRQFGRLVEMIMYKENLVNAFRHQVKRRLYLKNYDTLSEMTEAERK
DALQKSYLTIKEDYERITCSSKFKKRHAEEIEGLDSKKPKPEGA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggaactaactgatttcaaaccctcaacttggatttcttcttcaaaagattcgttaaaa
atatctttggtaagtaaggatggtgctgttcaatttgcacctatttttacatatcccata
ttcggagatgcagaacaaatcgttggttatcaagatttacttgttcatttggcgtttgat
tccattacatttaggccatttttaaatgttaaatactcaactaaactagatacggaagat
atcgatgacgttgaaggagagttgttaaaggttttaccaagtgataaggatgaagtcata
ttaaaagatgaagcaaaatgggttgatatgtttgaattcgaacagaagaactcgtttaaa
ctaccggaggataaatataaagttaacgaatatgaaatagataaggaacactttgtcgtt
tataaaatgaagctttctgatgatgaaaagtttttgaagttgcatcgtcgaattcagatt
ttttccctctttttcattgaagcagcttcctatattgatgaagaagattttaattgggat
atatattggctattcaataaggaaaagaagcaatgtatgggttatgccaccgcttacatg
tattggaaatacctcggtggaaaagattttgatgaatctaaagagcctaaacattacaga
gccaaggtctctcaattcttaattttaccgccatatcagggtaaagggcatggttcgaag
ctctatcaagcaatttttaagaattggttaagtaatgatttagtacgagaatttactgta
gaagatcctagtgagaattttgatgatttgagagatcgtaatgatttaaatttcttatat
gaaaatggattcttccaagaactatcttcgaaaattgtaaatgaaaaggatttcatctct
aatgaatggttgctatcaaaacaaagggcgtataagattgagaagaggcaatttggaaga
cttgtcgaaatgattatgtataaagaaaaccttgtaaatgcattcaggcatcaggttaaa
agaagattatatttgaagaactatgatactctttctgaaatgacagaagcagaaagaaaa
gatgcgctacagaaatcatatcttactattaaagaagactatgaaaggataacatgcagc
tctaaattcaaaaaaagacatgcagaagaaatcgaagggttggatagtaagaaacctaag
ccagaaggcgcctag

DBGET integrated database retrieval system