KEGG   Naumovozyma dairenensis: NDAI_0B02900Help
Entry
NDAI_0B02900      CDS       T02234                                 

Gene name
NDAI0B02900
Definition
hypothetical protein
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ndi  Naumovozyma dairenensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(737651..738709)
Genome map
AA seq 352 aa AA seqDB search
MGKKIVFNISSDFQLKSLLGEGAYGVVCSAVHKPTGEIVAIKKIEPFDKPLFALRTLREI
KLLKHFQHENIISIFDIQRPESFENFNEVYIIQELMQTDLHRVISTQNLTDDHIQYFIYQ
TLRAVKTLHGSNVIHRDLKPSNLLINSNCDLKICDFGLARIIEEDREDDDQMTQLQNGMT
EYVATRWYRAPEVMLTAAKYSKAMDIWSCGCILAELFMKRPIFPGKDYRHQLLLIFGLIG
TPFEEDLNCIESRRAREYIMTLPRYEPVPLSKVLPQVNPLGIDLLQRMLIFDPKKRITAE
EALSHPYLKTYHDPNDEPQGAPIPSSFFEFDHYKDVLTTKDLKKLLWNEIFC
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaaaagattgtattcaacatatcaagtgatttccaattgaaatccttattagga
gaaggagcatatggtgtagtttgttctgcagttcataaacccacgggggaaatagtagcc
atcaagaagattgaaccatttgataagccattatttgcattaaggacattacgagagatt
aaattattgaaacatttccaacatgagaatataatatctattttcgatattcaaagacca
gaatcatttgaaaattttaatgaagtttatattattcaagaattaatgcaaactgatctt
catcgggtgatttctacacaaaatttgacagatgatcatattcaatatttcatatatcaa
acattaagagcagtaaagacattacatggatctaatgtgattcatcgagatttaaaacct
tctaatttattaattaattctaattgtgatttaaagatatgtgattttggattagcaaga
attatagaagaagatcgtgaagatgatgatcaaatgacacaactacaaaatggtatgact
gaatatgtagcgacacgatggtatagagctcctgaagtgatgttaaccgcagcaaaatat
agtaaagcgatggatatttggtcatgtgggtgtatattagctgaactatttatgaagaga
cctattttcccggggaaagattatagacatcaattattgttaatatttggattaatcggt
acaccatttgaagaagatttaaattgtattgaatctagaagggccagggaatatattatg
acattaccacgatatgaacctgtccccttaagtaaagttcttcctcaagtgaatccattg
ggaattgatcttttacagaggatgttaatatttgatccaaagaagagaattactgcagag
gaggccctaagtcatccatatttgaaaacttatcatgatccaaatgatgagcctcaaggt
gctccaattccctctagtttttttgaatttgaccattacaaagatgtgttgactactaaa
gatttgaagaaattgttatggaatgaaatcttttgttag

DBGET integrated database retrieval system