KEGG   Naumovozyma dairenensis: NDAI_0B03170Help
Entry
NDAI_0B03170      CDS       T02234                                 

Gene name
NDAI0B03170
Definition
hypothetical protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
ndi  Naumovozyma dairenensis
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:ndi00514]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(804534..807128)
Genome map
AA seq 864 aa AA seqDB search
MAHKKKTTSSKSGSVKPSSEQQTTETTPDLFIEKGPVRPYIVTEPPKELTASRTITTMKE
KLMLLALIVFTASIRLPRLSQPNSVVFDEVHFGKFASYYIKGEFFMDVHPPLAKMLYAGV
AALAGFKGDFLFPEIGALYPKDVPYVVMRTFSAALGSCTVILLYLTLRASGVRSWIAFVC
GLCFAIENSYVTISRYILLDSPLIFFIAASAYAFKKYETYHSFSIGSLKTLIATGLCLGM
AASSKWVGLFTIAWIGLLCIWRLWFMVGDLSKSVKSVFMIAIMKLVCLLGIPTILYLLFF
QVHFQSLRFEGDGSSFLSSEFRSALIGNTIPQNMVYDVGVGSMVTLRHTGTMGGYLHSHQ
HNYPVGSEQQQITLYPHLDFNNEWIIESNNAPGVTFKSFHNLSDGTVIKLLHPGTQCRLH
SHDHKAPVSENSDWQKEVSCYGYPGFTGDGNDDWIIEIDKSKSVPGEAQERIIAINTKFR
LKHALSGCYLFSHETKLPEWGFQQQEVTCAHSGKAYLTLWYIEGSENPLLPEDTKRISYK
APSFLQKFIESHQKMWHINSNLVEPHYFESLPTSWPLLSRGISYWGDDTHHKTVYLLGNA
IVWWSVSAFIVVFAIVVLYELISWQVGKSILQDSNVVNFHVQVIHYLLGFAIHFAPSFLM
KRQMFLHHYLPAYYFGVLALGHALDITCTHVLKRKKTFAYIFLGVFFCASYYFFNNHTAI
IYGDEWTKEACKSSRWVSTWDYNCDIFLDKYEDYATLELETEETPLRTMPYPTLSSESSP
VIEINKNVVELEAEKVERQKPSDAPPVPGKETYDDIMKQPGAKIFKDQYGNSIDPDVAKQ
WLQQEGGSILRVEKKTVKTKLPKN
NT seq 2595 nt NT seq  +upstreamnt  +downstreamnt
atggcccataaaaagaagacaacgtcttcaaaatcgggaagtgtgaagccctcatctgaa
caacagaccactgaaactaccccagatttatttatcgaaaaaggtccagtaagaccgtac
atcgtcacagaaccaccaaaggaacttaccgcctctcgtaccatcacaacaatgaaggaa
aaactaatgttattagcattaatagtcttcactgcatccatcagattaccaagattatct
caacctaatagcgtcgtctttgatgaggttcatttcggtaaattcgcttcctattacatc
aagggagaattctttatggacgtgcatcctccattagccaaaatgttatatgctggtgtc
gctgcccttgccggattcaaaggtgatttcttatttccagaaatcggtgctctatatcca
aaggacgtcccatatgtagttatgagaacgttctcagctgcattgggttcatgtaccgtc
atcttattatatttaaccttacgtgcttccggtgttagatcttggatcgccttcgtttgt
gggttatgttttgccattgaaaattcatatgttactatctctcgttatatccttttggat
tctcctttgattttcttcatcgcagcctctgcatatgcctttaagaaatatgaaacttat
cattccttctcaattggatcccttaaaactttgatcgctactgggctttgccttggtatg
gctgcctcttccaaatgggtgggtttgtttaccatcgcttggatcggtctactttgtatt
tggagattatggttcatggtcggtgatttatctaaatcggttaaatctgtctttatgatt
gccataatgaaattagtatgtttattaggtatcccgacaatcttatatcttttatttttc
caagtccatttccaaagtttacgtttcgaaggtgatggatcaagtttcttatcatctgaa
tttagatcagctttgattggtaatacaatccctcaaaatatggtgtatgatgtaggtgtt
ggttctatggtcacattacgccatacggggactatgggtggttatttacattctcatcag
cataattatccagttggctctgaacaacaacaaattactctatatccacatttagatttc
aataatgaatggatcattgaaagtaataatgcaccaggtgttacttttaaatccttccat
aacttatccgatggtactgttattaaattattacatccgggtacccaatgtagattacat
tctcatgatcataaggctcctgtatccgaaaacagtgattggcaaaaggaagtttcttgt
tatggttacccaggtttcactggtgacggtaatgatgattggatcattgaaattgataaa
tcaaaatctgttccaggtgaagctcaagaacgtatcattgccatcaacactaaattcaga
ttaaaacatgctttatcgggttgttatttgttctctcatgaaactaaattacctgaatgg
gggttccaacaacaagaagtcacatgtgctcattcaggtaaggcttatttaactctttgg
tacattgaaggtagtgaaaatccattattgccagaagatactaaacgtatttcttacaag
gcgccatcattcttacaaaaattcatcgaatctcatcaaaaaatgtggcatatcaacagt
aatttagttgaacctcattatttcgaatcgttaccaacctcatggcctttattaagccgt
ggtatcagttattggggtgatgatacccatcacaagactgtttacctattgggtaacgcc
atcgtatggtggtccgtatctgcatttattgtcgtatttgccattgttgttctttatgag
ttgatatcatggcaagtcggtaagagtatcttacaagattcaaacgttgtcaatttccat
gttcaggtcatccactatttattaggttttgccattcatttcgctccatcattcttaatg
aaacgtcaaatgttcttacatcattatttaccagcttattatttcggtgtcttggctttg
ggtcacgcattagatattacatgtacccatgtcttaaagagaaagaagactttcgcctat
atatttttaggtgtgtttttctgcgcttcatattatttctttaacaatcatacagcaatc
atctacggtgatgaatggacaaaagaagcctgtaaaagttcaagatgggtttcaacatgg
gattacaactgtgacatcttcttggataaatacgaagattatgccaccttagaattggaa
actgaagagactccattgcgaacaatgccgtatccaaccctgtcttctgaatcatcgcca
gtaattgaaatcaataaaaacgttgttgaattagaagctgaaaaagttgaacgtcaaaaa
ccaagtgatgctcccccagttccaggcaaagaaacgtacgatgatataatgaagcagcca
ggtgcaaaaattttcaaggatcaatatggtaatagtattgatccagatgttgctaaacaa
tggttacaacaagaaggtggatctatcctaagagtggagaagaaaactgtcaagacaaaa
ctaccaaaaaactaa

DBGET integrated database retrieval system