KEGG   Naumovozyma dairenensis: NDAI_0B03430Help
Entry
NDAI_0B03430      CDS       T02234                                 

Gene name
NDAI0B03430
Definition
hypothetical protein
Orthology
K11870  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.4.19.12]
Organism
ndi  Naumovozyma dairenensis
Brite
Enzymes [BR:ndi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     NDAI_0B03430 (NDAI0B03430)
Peptidases [BR:ndi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   NDAI_0B03430 (NDAI0B03430)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(868578..871148)
Genome map
AA seq 856 aa AA seqDB search
MDQKIYENYLQNSSSYHSSSLPITISTAAAATTTTTTTTTTTTTGSFPLNIIDKYNNTNT
LVTTLLLAVLIPIMVYYRSNISSALHNNSNYGPSSSSGNGGGGGIMRRWMPRSSQMDSNV
LNHGGYIAGLLNDGNTCFMNSVLQSLASSKELMDFLDTTIKQEQEQEQEQEQVGDEKKED
VDIGFTLSLNELLSQLNAKYYKERPYFKTNKLLKTMKNAPNKNMLLGYDQEDAQEFFQNI
LSELEKNLKSISSQNNKEEEEEKKEQEKNSNECVKILKKDLPKDAIIGQEQLGKVGTVYI
PTEQIEPNTSTALPSSNPQEKLYTPFKLITPLDGISAERIGCLQCGENGGIRYSVFSGLS
LNLPNENIGMTLKLSNLLNEWIKPEIIDGVECNRCALEAIKSHLLDQLEQYHNNSTEIPQ
KLIDAVKDRVECLQKILSKPVIDEEDYKKLHTENMVRKCSKSKQILISRPPPLLSIHINR
SVFDVRTYQIRKNNSRVLFKSKLNLEPWTCDIDEINLDARLPMSKKESSLGQDEFSEDDE
ATTNGEYYNRLHQKYQQEFEDSSDEDDDSDDNEIYSMDNNRRRTRKDVRNYDPLNGEIED
SSSVYSSADEKDTHDSIEETDSLGNTIRKRVIKQETFERAEDSIEKENEGAEANHDDDND
DNNDEQEHKGNNDDELPSSSPLAASEEEEDGEVQETSLSPSGAIPQTIRKKFDSTPIGPL
TYSLRSVIVHYGTHNYGHYIAFRKYRGVWWRISDETVYIVDEAEVLSTPGVFMLFYEYDY
DEITGKLKDDLGLGDEDIDIEMETPENNDMDVVVENESEDENEEELMEEKEQRQQQEEEE
EEVAAEKEDEVLEPID
NT seq 2571 nt NT seq  +upstreamnt  +downstreamnt
atggatcaaaaaatatatgaaaattatttacaaaattcttcatcttaccattcctcatca
ttaccaataacaattagtaccgcagcagccgcaacaacaacaacaacaacaacaacaaca
acaacaacaacagggtcattcccattaaatatcattgataaatacaataatacaaacaca
ttagtcacaacattattattagcagttctaatccccataatggtatattacagatcaaac
atctcctcagcattacataacaatagtaactatggtccatcatcatcatcaggtaacggt
ggtggtggtggcatcatgcgtcgttggatgcctagaagttctcaaatggatagtaacgtc
ttaaaccatggtggatatatcgctggtttacttaacgatggtaatacatgttttatgaac
tctgtattacaatcattggcatcttctaaggaattaatggatttcttagacaccactatc
aaacaagaacaagaacaagagcaagaacaagagcaagttggagatgaaaaaaaggaagat
gtggatattgggttcactttgtcattgaatgaattattaagtcaattgaatgcaaaatat
tataaggaaagaccatattttaagactaataaattattgaaaactatgaaaaatgcacct
aataaaaatatgttgcttgggtatgatcaagaagatgctcaagaatttttccaaaatatt
ttatctgaattagaaaagaatttgaaatcaatatcatcacaaaataacaaagaagaggaa
gaagagaaaaaggagcaggaaaaaaattctaatgaatgtgttaagatattgaagaaggat
ttaccaaaggatgctattattggtcaagaacaattagggaaagttggtactgtctatatt
cctactgaacaaattgagccaaatacttcaacagctttaccttcttctaaccctcaagaa
aaactatatactccattcaaattaataactccattagatgggatttctgcagaaagaatc
ggttgtttacaatgtggtgaaaatggtgggattagatattctgtattttcaggactaagt
ttaaatttacctaacgaaaatatcggtatgacattaaaattatcaaacttattaaatgaa
tggataaaaccagaaattattgatggtgtagaatgtaaccgttgtgcattagaagctatc
aaatctcatttacttgatcaattagaacaatatcacaataatagtacagagatcccacaa
aaattaattgatgctgtcaaagatagagttgaatgtttacaaaagatattatcaaaacca
gttattgatgaggaagattataaaaaattacacactgaaaatatggtacgtaaatgttct
aaatcaaagcaaatcttaatatctaggcctccccctttattgtccattcatattaataga
tctgttttcgatgttagaacttatcaaattaggaaaaataattcaagagtgctctttaaa
tcgaaattgaatttagaaccatggacatgtgatatcgatgagattaatttggatgcaaga
ttaccaatgtcaaagaaagagtcatcattaggtcaggatgaatttagtgaagacgatgaa
gcaaccactaatggtgagtattataatagattgcatcaaaagtatcaacaagaatttgaa
gatagtagtgatgaagatgatgatagtgatgataatgaaatctattcaatggataataat
agaagaaggacgagaaaagacgttagaaattatgatccattaaatggggaaattgaagat
tcatcatctgtttattctagtgctgatgaaaaggatactcatgattccattgaagaaacc
gattcgttaggaaatactattcgtaagagggttatcaaacaagaaacctttgaaagagct
gaagattctattgaaaaagaaaatgaaggagcagaagcaaaccatgatgatgataatgac
gataataacgacgagcaagaacataagggtaacaatgacgatgaattaccctcttcttct
ccattggcagcatctgaagaagaagaagatggtgaagttcaagaaacatctttatcacca
tctggtgctatcccacaaacaattagaaagaagtttgattctacgccaattggtccatta
acttattcattacgttcagttatcgttcattatggtactcataactatggtcattatatt
gcctttagaaaatatagaggtgtttggtggaggatttctgatgaaacagtttatattgtt
gacgaagcagaagttctttctactccaggtgtttttatgttattttatgaatatgattat
gatgaaattacagggaaattgaaggatgatttaggattaggtgatgaagatattgatatt
gagatggaaactcctgaaaacaatgatatggatgttgttgtggaaaatgaaagtgaagat
gaaaatgaagaagagctaatggaagaaaaagaacaaagacaacagcaagaagaagaagaa
gaagaagtagcagctgaaaaggaagatgaggtgctggaaccaatagattaa

DBGET integrated database retrieval system