KEGG   Naumovozyma dairenensis: NDAI_0B05810Help
Entry
NDAI_0B05810      CDS       T02234                                 

Gene name
NDAI0B05810
Definition
hypothetical protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ndi  Naumovozyma dairenensis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ndi00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1412089..1413822
Genome map
AA seq 577 aa AA seqDB search
MCGIFAAFKHEDVHAFKPRALQLSKRIRHRGPDWSGNVIKNTTILAHERLAIVGLDSGAQ
PITSPCGNYTLCVNGEIYNHIQIREQFPDYPFKTLSDCEPIIPLYLKHDIDTPKHLDGMF
AWCLYDSKQDRIIAARDPIGITTLYMGRNSKTPQTVFFASELKCLTDDCDSIIAFPPGHV
YDSKTDQITRYFTPDWLDEQRIPENKLDLTAIRESLESAVRKRLMAEVPFGVLLSGGLDS
SLIASIAARETEKANAQATLDNENANDETSKAHLTGVDDEGHLHNGGWSKLHSFAIGLPN
APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANKSTMAWG
LEARVPFLDRDFLQLCMNIDPKEKMINQAEGRIEKYILRKAFDTSDDPEAKPYLPEEILW
RQKEQFSDGVGYSWIDGLKDTAERVISDAMFENPKDHWGTDIPTTKEAYWYRLKFDALYP
QKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHVNA
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtattttcgcagcattcaaacatgaagacgttcatgccttcaaaccaagagct
ctacaactttctaaaagaattagacaccgtggtccagattggtcaggtaacgtcatcaaa
aacaccactatcttagcccacgaaagattagccattgtcggtctagattccggtgctcaa
ccaatcacttccccatgcggtaactacacattatgtgtcaacggtgaaatttataatcat
attcaaataagagaacaattcccagattatccattcaaaaccttaagtgattgtgaacct
atcatcccattatatttaaaacatgacattgacactccaaaacatttagacggtatgttc
gcttggtgtttatatgattctaaacaagatcgtatcatcgcagcaagagatccaatcggt
ataacaactttatacatgggtcgtaactccaaaactccacaaactgtattcttcgcatct
gaattgaaatgtttaactgatgattgtgatagtatcatcgcattcccaccaggtcacgtg
tacgattcaaagactgaccaaattactcgttatttcactcctgattggttagatgaacaa
agaatcccagaaaataaattggatttgaccgctattagagaatctttagaatctgcagtc
agaaagagattaatggctgaagtcccatttggtgtcttattatctggtgggttagattct
tctttaattgcatctattgctgctcgtgaaactgaaaaggcaaacgctcaagccacattg
gacaatgaaaacgctaatgatgaaacttctaaggctcatttgactggtgttgatgatgaa
ggtcatttacataatggtggttggtcaaaattacattctttcgctattgggttaccaaac
gctccagatttacaagctgctagaaaagtcgctaaattcattggatctattcatcatgaa
catactttcactttacaagaaggtttagatgcattggatgatgttatttatcatttggaa
acttatgatgttaccactattagagcttccactccaatgttcttattatcaagaaagatt
aaagctcaaggtgttaagatggttctttctggtgaaggttctgatgaaatttttggtggt
tatctatatttcgctcaagctccatctgctgctgaattccatactgaatccgttaagaga
gttaataacttacatttagctgattgtttaagagctaacaaatctacaatggcttggggt
cttgaagctcgtgtcccattcttagatagagatttcttacaattatgtatgaacattgat
ccaaaggaaaaaatgattaatcaagctgaaggtcgtattgaaaaatacatcttaagaaag
gcattcgatacatctgatgatccagaagctaaaccttacttaccagaagaaatcttatgg
agacaaaaggaacaattctctgatggtgtaggttattcatggattgatgggttgaaagat
actgctgaaagagtcattagtgatgctatgtttgaaaatccaaaggatcattggggtacc
gatattccaactacaaaggaagcttattggtatagattgaaattcgacgctttataccca
caaaagactgccgctgatactgtcatgagatggattccaaaggctgattggggttgtgct
gaagatccttctggtagatatgctaagattcatgaaaaacatgttaatgcttaa

DBGET integrated database retrieval system