KEGG   Naumovozyma dairenensis: NDAI_0B05990Help
Entry
NDAI_0B05990      CDS       T02234                                 

Gene name
NDAI0B05990
Definition
hypothetical protein
Orthology
K04646  
clathrin heavy chain
Organism
ndi  Naumovozyma dairenensis
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    NDAI_0B05990 (NDAI0B05990)
Exosome [BR:ndi04147]
 Exosomal proteins
  Proteins found in most exosomes
   NDAI_0B05990 (NDAI0B05990)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1449819..1454762
Genome map
AA seq 1647 aa AA seqDB search
MSDLPIEFTELVDLTSLGISPQSLDFRSTTFESDHYVTVRESNEGSNTVSIVDLLNGNQV
TKKNMGGDSAIMHPSQMVISVRANGTIVQIFNLETKSKLKSFTLNEPVIFWKWLNEETLG
FVTANSILTSNVFDGNVSAPPQLLTQRHMNLNNTQIINFVANAKLDWFAVVGILQENGRI
AGKIQLYSKQRNISQAIDGHVASFTNILLEGNGTSSVQVFVTGNRNVTTGTGELRMIEID
HDASLPTQYQKKTSDIFFPPDATNDFPIAVQVSEKYGIVYLLTKYGFIHLYELETGTNLF
VNRITAESVFTATSYHDKNGIACINKKGQVLAVEIATSQIVPYILNKLSNVSLALTVATR
GGLPGADDLLTKQFETLLNQNDYQTAAKVAASSQSLRNQNTINRLKNIQAAPGTISPILV
YFSTLLDKGKLNKEETIELARPVLQQDRKQLFEKWLKEDKLECSEELGDIVKPFDTTLSL
ACYLRCQAHAKVIASLAELQQFEKIIPYCQKVDFQPNFLVLISTIVRTNADRASEFAISL
LQNPETASQLDIEKIADIFFSQNHIQQGTSLLLDALKTDTPDQGHLQTRVLEVNLLHAPQ
VADAILGNNIFSHYDKPTVAQLSEKAGLFQRALENYTDITDIKRCIVHTDSLPIDWLVAY
FGKLNVEQSLACLRALMDNNLKANIQIIVQVATKFSDLLGSATLIKLFDEYNATEGLYYY
LASLVNLTEDKDVVYKYIETAAKMKQFNEIERIVRDNSVYDPERVKNFLKDANLEDQTPL
VVVCDRFNFVHELILYLYKNHNMKFIETYVKQINPSRTAQVVGALLDMDCDERFIQDLLQ
SVLGQVPIDELTTEVEKRNKLKLLLPFLEATLAQGSQEQTVFNALAKIYIDSNNSPEKFL
KENDQYDTLDVGRYCEKRDPYLAYIAYDKGHNDDDLIRITNENTMYKYQARYLLQRSDPE
LWNKVLDAENVHRRQLIDSVISVGIPELTDPEPVSLTVQAFMSNGLKLELIELLEKIILE
PSPFNDNVALQGLLLLSAIKYEPGKVSNYIERLENYDADEIAPLCIANDLKEEAFEIYDK
HEMYSKALKVLVEDIMSLDRAATYVDKINTPEMWSQLGAAQLDGLRIPDAIESYIKAEDP
SNFVNVIDLAEQAEKYEELVPYLLMARKTLKESKIDGSLVLAYAQLDKLHEIENILAGSN
VANLDQVGDKLFDLKDYKAAKLCYSSVSNYSKLASTLVYLDDYQGAVDTARRASNIKVWK
LVNNACIEKKEFRLAQICGLNLIIHAEELDELVDQYEASGYFEELISLFEAGMGLERAHM
GMFTELAILYSKYQPSKTFDHLKLFWSRINIPKVIRAVDDAHLWKELVFLYAHYDEWDNS
ALTMIEKSTKDFDHGYFKEVIVKVSNLEIYYKAINFYVKEHPSLLIDLLTVLTPRLDIPR
TVKQFVTSDNLPLIKPFLINVLPKNNTVVNAAYHDLVIEEEDYKALQDAVDAYDKFDQIG
LAARLESHDLVFFKKIAALLYRRNKKWAKCLAILKNEKLWKDAIETAAISQDAKVVEELL
TYFVDTGNKEAFVALLYTAYNLVKYDTVLELSWLNSLDNYIKPFEISVKKEENDAIQRLS
TMIDKMDTTEPSTEGQPLMLMNSSMNM
NT seq 4944 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatcttcctatcgaatttacagaattggtggatctaacatccttagggatctct
cctcaatcactcgatttcagatctaccacttttgaaagtgatcattacgttactgtaagg
gaatcaaatgaaggttccaatactgtttccattgtagatttattaaatggtaatcaagta
acaaagaaaaacatgggtggtgactctgctatcatgcatccatctcaaatggtcatctct
gtaagagcaaatggtaccattgtacaaatatttaacctagaaacaaaatcaaaattaaag
tctttcactttgaacgaacctgtaatattttggaaatggttgaatgaagaaacattgggg
tttgttactgcaaattctatccttacttcgaacgtattcgatggtaacgtgagtgcacct
cctcaattattaactcaaagacatatgaatttaaacaatactcaaattattaatttcgtc
gctaatgctaaattggattggtttgctgtcgtaggtatcttgcaagaaaatggtcgtatt
gcaggtaaaattcaattatactctaagcaacgtaatatttctcaagcaattgatggtcac
gttgcaagtttcacaaacatcttattagaaggtaatggaacttcttcagttcaagttttt
gtaacaggtaatagaaatgttactactggtactggtgaattaagaatgattgaaattgat
catgatgcctccttaccaactcaataccaaaagaaaactagtgacatctttttcccccct
gatgctactaatgatttcccaatcgctgttcaagtctcagaaaaatacggcattgtttat
ttattgaccaaatatgggttcatccatctttatgaattagaaactggtactaatttgttc
gttaatagaattactgcagaatctgtttttactgctacttcataccacgataagaatggt
attgcttgtatcaataaaaagggtcaagttcttgctgtggaaatcgctacttcccaaatt
gttccatacatcttgaataaactatctaatgtttcgttagctttaactgtagcaacaagg
ggtggattaccaggtgcagatgatctattgaccaaacaatttgagacattattgaaccaa
aatgattaccaaactgcagcaaaagtcgccgcttcctctcaatctttaagaaatcaaaat
actatcaatagattgaaaaacattcaagctgctcctggaacaatttctccaattcttgtt
tatttctcaactttattagataagggtaaattgaacaaagaagaaactattgaattggca
agacctgttttacaacaagatagaaaacaattattcgaaaaatggttgaaggaagataaa
ttagaatgttccgaagaattgggtgatattgttaaaccattcgatactactttatcccta
gcatgttatttaagatgtcaagctcatgctaaagttattgcatctttagctgaattacaa
cagtttgaaaaaattatcccatattgccaaaaagttgacttccaaccaaatttcttagtt
ttaatctctacaatcgtgagaactaatgctgatagggcatctgaatttgccatctcctta
ttgcaaaatccagaaactgcttctcaattggatattgaaaagattgctgatattttcttc
tctcaaaaccatatacaacaaggtacatctttacttttagatgctttgaaaactgatact
ccagaccaaggccatttgcaaactcgtgtcttagaagttaatttattacatgctccacaa
gttgcagatgctatcttaggtaataacattttctctcattatgataaaccaactgtggcc
cagttatctgaaaaggctggtttattccaaagagctttagaaaattacactgatattacg
gatattaagagatgtattgttcatactgactctttaccaattgattggttagtcgcatac
tttggtaaattaaacgtggaacaatcattagcttgtttaagggctctaatggataataac
ttgaaggcaaatattcaaattattgttcaggtcgctactaaattctcagacctattgggc
tctgccactttaatcaaattgtttgatgaatataatgcaactgaaggtttatactattat
ttggcttcattagttaatttgaccgaagataaggatgttgtttacaagtatattgaaact
gctgccaagatgaaacagtttaatgaaattgaaagaattgttagagataacagtgtttat
gatcctgaaagagttaagaatttcctaaaagatgctaatttggaagatcaaaccccatta
gttgttgtttgtgaccgtttcaatttcgtccatgaattgatcttatacctatacaagaac
cacaatatgaaattcattgaaacttatgttaaacaaatcaatccttcaagaactgcacaa
gttgttggtgctttattagatatggattgcgatgaaagatttatccaagatttattacaa
tctgtccttggtcaagttccaattgatgaattgaccactgaagttgaaaagagaaacaag
ttgaaattattactaccattcttggaagcaactttagctcaaggtagtcaagaacaaact
gtattcaacgccttggccaagatttatattgactccaataattcgcctgaaaaattcctg
aaagaaaatgatcagtatgatacgctagatgtcggtcgttattgtgaaaagagggatcca
tatttagcttatatcgcttacgataaaggtcataatgatgatgatttgattagaatcacc
aacgaaaatacaatgtacaaataccaagcaagatatttgttacagcgttccgatcctgaa
ttatggaataaagttcttgatgctgaaaatgttcatagacgtcaattaatcgattctgta
atctcagttggtattccagaattaaccgatccagaaccagtttcattaactgttcaagct
ttcatgagcaatggtttgaagttggaattaattgagttattggaaaagatcatcctagaa
ccttctccatttaatgataatgttgccttgcaaggacttttgcttctttctgcaattaaa
tatgaacctggtaaagtgtctaattatattgaaagattggaaaactatgacgctgacgaa
attgctccgttatgtattgcgaatgacttgaaagaagaagctttcgaaatttatgataaa
catgaaatgtatagtaaggcgttaaaggttctcgttgaggatatcatgtcgttagataga
gcagcaacatacgttgacaaaattaatacaccagaaatgtggtctcaattaggtgctgca
caattggacggtttgagaattccagatgccattgaatcttatattaaggcagaagatcca
tctaattttgtcaatgttattgaccttgctgaacaagctgagaaatatgaagaattggtt
ccatatttattgatggctagaaagacgttgaaagaaagtaagattgatggttctttagtt
ctcgcttatgctcaattagataaacttcatgaaattgagaacatattagctggttccaac
gttgcaaacctggaccaagttggtgataaattatttgatttgaaagattacaaagcggcc
aagttatgttattcgagtgtatccaattactctaaattggcttcgactttagtttattta
gatgattatcaaggtgctgtcgatactgctagaagggcttctaacattaaggtttggaaa
ttagtcaataatgcttgtattgaaaagaaggaatttagattagctcaaatttgtggttta
aacttgattattcatgctgaggaattagatgaacttgttgatcaatacgaagctagtggc
tactttgaagaattgatatctttattcgaagcaggtatgggtttagaaagggctcatatg
ggtatgtttaccgaattggcaatcttatactccaagtatcaaccctccaagacatttgat
cacttgaagctgttctggtctagaattaacattccaaaagttattagggcagtagacgat
gctcatttatggaaagaactggtgtttttgtacgcccattatgacgaatgggataattct
gctttgaccatgattgaaaagtccacgaaggatttcgatcacggttactttaaggaagta
attgttaaagtctcgaacttagaaatatattacaaagcaattaacttttatgttaaagag
cacccatccttgttgattgacttgttaaccgtactaacaccaagattagatattccgaga
actgttaaacaattcgttacgtctgataacttacctcttatcaaaccatttttgattaat
gtgttaccaaaaaataatacagtagtcaatgcagcctatcatgatttagtcattgaagaa
gaggattataaagctctacaagacgccgttgatgcatacgataagttcgatcaaatagga
ttggctgcacgtttggaatcacatgatttagtcttctttaagaaaattgcagctttatta
taccgtagaaacaagaaatgggcgaaatgtcttgctattttgaaaaatgaaaaactatgg
aaagatgctattgaaacagctgctatttctcaagatgcaaaggtagttgaagaactattg
acgtacttcgttgacaccggtaacaaagaagcgtttgttgctttgttgtatactgcttat
aatcttgtcaagtatgacactgttcttgagttgtcgtggttgaattcattagacaattat
atcaagccatttgagatttctgtgaaaaaggaagaaaacgatgctattcaaagactctct
acaatgattgacaagatggatactactgaaccatccactgaaggccaaccattgatgtta
atgaacagttctatgaacatgtaa

DBGET integrated database retrieval system