KEGG   Naumovozyma dairenensis: NDAI_0C01550Help
Entry
NDAI_0C01550      CDS       T02234                                 

Gene name
NDAI0C01550
Definition
hypothetical protein
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.1.2.15]
Organism
ndi  Naumovozyma dairenensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:327953..331840
Genome map
AA seq 1295 aa AA seqDB search
MTFLRPDEDSTKKESSNIDSLNSSFESVNMDQSSTNSDKPDLPSKTNDDETNKSNPNSTG
QGPTCDTPRVTTQDIDPGNTLLYPDLGTANFPMKTSNRIIDDILCDLSFINGPNLSFKNG
ILQESMIMYSKERINNQAYLFGSMVDQVALQTKYEYNSLTCPANNKLEVQFGILMNLPSN
ITNVDEIISKVPIYHLKITVKTRQLLEVSKKQAGITQYHLLDFEDLHHFDKRDLMTFDPD
NPDLLDYAIYVSSDTNRLILIEIFSTEFDSREERESFQTATIKSRYQEACKKFDTLDPEA
VPTGIDCLNTVLKLLKQPLTRKNNNDKIRTVSSNNPILHSHFNPEWLLEKYNFTKHYATD
ETTGQEVLEYEPPDLISYVQGYKVRSLREKYIRRCLQLIFWGKCLVQLRVDQSDPALRGS
KSYRAFNLLNTTTSTNPLYQLLNDSKSNFLASTRNDSDSMALDQNFHFINLSTSSYYTDR
DIIKNYERLIALDPPNIGTYFDALSYIANRKGSYQLIAYCGKQDVVGQENINMALKCFNI
DPNVVNLESIDDSLLLSIYKNESVKEGADFVNLKNAMRLFAKIRNSPQLKFYVDHEPYRN
VNQAYETLEIDSSVDDDIIQTAYSIKTVDAPGLKIDCDRALYTIAIQRRSMILFNFLLEN
CSEFQAYYNIGRYDYRQALGILQVNENANDEVILKNFQTKWFNEQIHEADQFLNYKCALM
KLGLERNSKLINNFLMNGVIDPSCLPVENWPTGINNIGNTCYLNSLLQYYFSISPLREYV
LGYSKTYEDFYDAKRNAKTIRRIGGREVGDNEVERSIQFIYQLRDLFYAMIYTNKRCVTP
RRELAYLAFAPSNVEVEFENGVTDAKEDVSHYNDDKTSDTLIKIGEGDEDLGEAERTEAS
PTEDIYMTDDDMLGAAKATDGINKEDESTENGIDILPSTKVAKISSDQLENALEMGRQQD
VTECIGNVLYQLESGSEPLQINPEDNEQDDLVKQLFYGEIKQDIIPLSGVGETRPKLERF
LSLLVNVGDHPRDIYDALDMYFKDEFLTMDEYGEVKRTVAITKFPTILQVQIQRVYYDRE
RFMPFKSIEPLPFSAKIYMDRYVDTADPEILETRERTAKMKAELVQLKKRQQELLSRNEV
GLSRKEAYSETVNFLQSNALQLQGIVFEGQDELSTILKKAGTDIDDELSTIYNQITQLEE
TISHQFEQFKKVGYSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEV
FNFTEGNTATPYFLVYVKEGSEKDIEPLKRIIEES
NT seq 3888 nt NT seq  +upstreamnt  +downstreamnt
atgactttcttacgtcctgatgaagattcaactaaaaaggaatccagtaacatagatagc
ctgaattcaagttttgaatcggtcaatatggaccaatcttcaacaaattcagataaaccc
gatctcccctcaaaaactaacgatgatgagacaaacaaatcgaatccaaatagtacggga
cagggaccaacatgtgacactccaagggtgacaactcaagatatagatcctggtaataca
ttattatatccagatcttggtaccgcaaacttcccaatgaaaacttccaatagaatcatc
gacgatatcctttgtgacttatcatttattaatggtcctaatttgtcattcaaaaacggg
atattacaagaatctatgataatgtattccaaggaacgtatcaataatcaggcttacctt
tttggttcaatggtagatcaagttgcattacaaactaagtatgaatataattcgcttact
tgtccagcaaataataagctagaagtacagtttggaatattaatgaatttaccatctaat
attacaaatgtcgatgaaatcatctctaaagtccccatatatcatttgaaaattactgtt
aagactcgtcaattgttagaagtttccaaaaaacaagccgggataactcaatatcatttg
ttagattttgaagatcttcatcatttcgataaaagagacctaatgacatttgaccctgat
aatccagacctattagattatgctatttatgtctctagtgataccaacagattaatcttg
attgaaatcttctccactgaatttgactctagggaagaacgtgaaagtttccaaacagca
actattaagagtcgctaccaagaagcatgtaaaaagtttgatacattagaccccgaggcc
gttcctactggaattgattgtttaaataccgttttgaaactgctgaaacaacctttgact
aggaaaaacaataatgataaaataagaacagttagttctaacaatcctattttacattca
cattttaatccggaatggttacttgaaaaatataatttcacaaaacattatgccactgat
gagaccacaggacaggaagtacttgagtatgaaccaccagatttaataagctacgtccaa
ggttataaagtaagatcgcttcgagaaaaatatattcgaagatgtttgcaacttatcttt
tgggggaaatgtttagttcaattaagagtagatcaatctgatccagcgctgagaggttct
aaatcatatcgtgctttcaatttattaaataccacaacttctacaaatcccttatatcag
ttattgaatgattctaagtcaaattttctagccagtacacggaacgactctgattcaatg
gcattggatcaaaacttccatttcattaatctttctacttcatcatactacacagatcgc
gatattattaaaaattatgaaagattaatcgcgttagatccgccaaatatcggaacatat
tttgatgcattaagttacatcgccaaccggaagggatcatatcaattaattgcatattgt
ggtaaacaagatgttgtcggtcaggaaaatatcaatatggcattgaaatgttttaatatt
gatcctaatgtagttaacctggaatccatcgatgatagtcttttgttatccatttataaa
aatgaatctgttaaagagggagcagattttgttaacttgaaaaatgcaatgagattgttt
gccaaaattagaaactctccacaattgaaattttacgttgatcatgaaccgtatcgaaat
gtaaatcaagcctatgagactttggaaattgattcatccgttgatgatgatattatccag
accgcatatagtatcaagacagtcgatgctccaggattgaaaatagattgcgacagagca
ttgtatactattgccattcagaggagaagcatgatattattcaattttctactagaaaat
tgttccgaattccaagcttactataatataggcagatatgattaccgtcaagctttggga
atattgcaagtcaatgaaaatgcaaacgatgaagtaatcttgaagaacttccaaacaaaa
tggtttaacgaacaaatacatgaagctgatcaatttttaaattataagtgcgcgttaatg
aaattgggattagaaaggaactctaaattgattaataatttccttatgaatggggtcatt
gatccatcatgtttgcccgtggaaaactggccaactggtataaataacataggtaataca
tgttatctgaattctttgttacaatattatttttcaatatcaccgttgagagaatatgtt
cttggttattctaagacgtatgaagatttttatgatgcaaaacgaaatgctaaaacaatc
agaagaattggaggaagagaagttggtgataatgaagtggaaagatctatccaattcatt
tatcaattaagggatttgttctatgcaatgatttatacaaataaaagatgtgttacacct
aggagagaattagcctacctcgcatttgccccaagcaatgtggaagttgaatttgaaaac
ggcgttacagatgctaaagaagatgttagccactacaatgatgataagacaagtgacacc
ttaataaaaataggtgaaggtgatgaagatttaggggaagctgaacgaaccgaggcatcg
cctacagaagatatttacatgactgacgatgatatgcttggcgctgcaaaagcaactgat
ggaatcaataaggaggatgaaagtacagaaaatgggatcgatattttaccatctacaaaa
gttgccaaaataagctcagatcaattagaaaacgcattagaaatgggtagacaacaagat
gtaacagaatgtattggtaacgttctttaccaattggaaagtggttcggaacctcttcaa
attaatccagaagataatgaacaagatgatttggtaaagcaattattttatggggaaata
aaacaagatattatcccactatctggtgttggtgaaactcgtccaaaactggaaagattt
ttatctctgttagttaatgtaggtgatcatccaagagatatttatgatgcattggatatg
tattttaaagatgagttccttacaatggatgagtatggagaagtgaaaaggacagttgcc
atcactaaattcccaacaattttacaagtacaaatccaaagagtatactatgatcgagag
agattcatgccatttaaatctattgaacctttacctttcagtgccaaaatatacatggac
aggtatgtagatacggctgatccagaaatattggaaacaagagagagaactgcgaaaatg
aaagcagaacttgttcaattaaagaaaaggcagcaggaattattgagtagaaacgaagta
gggctttcacggaaagaagcatattctgagacggtgaatttcttacagtctaacgcatta
caattacaaggtatcgtgtttgaagggcaagatgaattaagtacaatcctgaaaaaagct
ggaactgatatcgatgacgaattgtcaacgatatataatcaaattacccaattggaagaa
acaattagccatcaatttgagcagttcaagaaagtgggttattcactatttgcagttttt
atccatcgaggtgaagcaagttacgggcattattgggtatatatcaaagattataaccaa
aatggtatatggaggaagtacaatgacgagactgttagcgaagtccctgatgaagaagtg
ttcaacttcacagagggcaatacagctacaccatattttctcgtctatgtaaaagaaggc
agtgagaaagacattgaacccctgaagaggattattgaggagtcttag

DBGET integrated database retrieval system