KEGG   Naumovozyma dairenensis: NDAI_0C01580Help
Entry
NDAI_0C01580      CDS       T02234                                 

Gene name
NDAI0C01580
Definition
hypothetical protein
Orthology
K05759  
profilin
Organism
ndi  Naumovozyma dairenensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(join(339182..339549,339677..339689))
Genome map
AA seq 126 aa AA seqDB search
MSWQAYTDNLLATGKVDKAVIYSRAGDSVWATSGGFQLQANEISEICQGFDNPAGLQSNG
LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVLVAHYPPTVQAGEATKIVEQLADY
LISVQY
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggcaagcgtacactgataacttactagctactggtaaagttgacaaagcagtt
atttactcaagagcaggtgattctgtatgggccacttcaggtggattccaattacaagct
aatgaaatctctgagatatgccaaggttttgacaatccagccggtttacaaagtaatggg
ttgcacattcaaggtcaaaaatttatgttattgagagctgatgatagaagtatctacggt
agacacgatgctgaaggtgttgtttgtgttagaacaaaacaaacagttttggttgctcat
tatccaccaactgttcaagctggtgaagctacaaagatcgttgaacaattggctgactat
ttaatcagtgttcaatattaa

DBGET integrated database retrieval system