KEGG   Naumovozyma dairenensis: NDAI_0C02230Help
Entry
NDAI_0C02230      CDS       T02234                                 

Gene name
NDAI0C02230
Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
ndi  Naumovozyma dairenensis
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:ndi03013]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:496825..502041
Genome map
AA seq 1738 aa AA seqDB search
MIWSTAPFQKLYDSIENDQFDYNLFKELLPDLQQLNLTNDKPKNQKSRAQVESGKITLAD
NNIITNDDENDTNNNHNTITYNLKQQFIIATISLSDELNLDELIVAQLILSDLEKSNLLD
SLDSLDNATTLIISGKRQFFFRRQFILQITAFLLNCLDTSNPILQELVQDSLKNNILKSF
ESIHQQLEDIKQSINKAKILENNNDPIFIQNIKFKRDFLLKEYDTLSQILTGLINKNFLL
NYNDINNIINHIITSLNPNDYFIIYYLPALFNAFNKLEDMPSNDVNLLYSNFIKDLKNND
SIYEQPIKVTLIFIFLTLFIDWCNSNPTVRTKDLDFKTDIDYPMMLTVELGAIEQLLIIA
ADTSEFMNDQTLELIYDIRSLLETHIPRFRPIQLLDDPVDYENASNNDNNNNNTQHPHSI
TNNFSYSDAINTKKGITPSENKNLKYSNIAQSQYNNIRLSEQTQDFLVSSFHNVLQKVIT
NCAFLLTKIKDTEEDSLLSEADLTLDDIAAKADLERFFITIYFFYASRPTYSNEFWKDKE
SNAYGFIEWSSKCTDSLMRSCFYLMISSLSFGQENSTNVFHYFGNNSIVSWSTIVQCLKE
YNLRISNLPNVIHQRQNLEQDTDSSSSSSSATATKEIDSLAIAFEEGLNEETTIFLSSLL
TLVGSVAFDVQSDIKISLSGLFMDPIFEFAKLETPLSGACFKTLSYLLPSSIDARLNYWQ
SLDSILFKNVSLTNTTDSYRSAFGYTLKTFSEIVGFLSLFNNLLKINPQDINENGHLSFG
KQNFPSKLGQVYRKMGIWPYFDYILNEIFVPSKLILNDFDRRAIQTPILEIIETSLLSFD
YSAILNSITLGINLDTLVNTSDFFTYVQESPAPVVFNHLFAQNVHSTLFAIIDIGIDHIS
IDLEGGKDQMNLLTRSIKIINLILDFQGTFTEELLPIIIKQENKSYYIPKNFGLHGFRSF
YDTIFFNLPVVAHLGLYVGLDDTSLVSESLKVLKKLSLNSPSNGTDLNSKNKLFTIFDAV
DDSARIKDAFISQLEVPIENDGQLSLKIQLLNFINSNLSFTKPAVTVAHFLLGLQASNGI
SLGPELPTFINSDVSLLNSIVSILESSLDIVTPEQIQYAPMRLASISLEIILKLCRNPLT
SSLLLDYLTNQHFFERIMEIDVHITKFTQWDGKSFDSLSIDSGFDFLQSESIGALLAFLS
YRNYLIQYLGLFIHRCSFMGTKRNILTYVNFLITNKIYSTRIFSFLDSLNYENLPIDEHL
FKNFKYLNALPLNLEKFTLNEKCAGNIYSLNDLNSLMSVAQKVVKPPLHATACTTDEVGE
AQKETLVKEIVMMKFCVSSYLSNKKFQELQLLILHSWVQLVQVIVTDGNLSPLSRSNFIL
EVFETIIPKINDYVEVNTLFSEELTSLAVFLNDLYQKDRMVVDNLRFVDSRLYNMFKVCL
HGINSPLSTPTLRSDFYVLANSYLVRRIKENTLVKEVIMDIRMHNEKLLEVICNDAIYVQ
GTCKITGILLLDSLIQLGNINKANFVLDNLMKGTQLQRIAQTLKSTDLLLTSTAEHITID
DLLYELTAFKTTASFLVRVAETRIGAQSLLQCKILQIIGDLSFLKIDPDLGSELIFNESP
SKNSDFIKVNINLTNSINGVASSNGVSLFEVITPIFRLLCSILLSLGSTNKSVISNVKKL
LMEFRKLLVGIFKKDVLKETQDTVQSTKSASEDWQELVKLAVVLCTLTQYDGRESSML
NT seq 5217 nt NT seq  +upstreamnt  +downstreamnt
atgatatggtctaccgccccattccaaaaattgtacgattctattgaaaatgatcaattc
gattataacttgttcaaagaattgttaccagatttgcaacaattgaatcttaccaacgat
aaacctaaaaaccagaaaagtagggcacaagtggaatcagggaaaattacattagcagat
aataatattattacgaacgacgatgagaatgatactaataataaccacaacacaattact
tataatcttaaacaacaattcatcattgccaccatctccttgtcggatgaattaaatttg
gatgaactgattgtggcccaattaattttgtctgacttagaaaaatctaatctattagat
tccttagattcactagataatgcaacaactttaattatttcaggtaaacgtcaatttttc
ttcagaaggcaatttatcttacaaattaccgcctttcttttaaattgtttagacacttca
aacccaatattacaagaattggtacaagattcattgaaaaataatatattaaaatctttc
gagtcaattcatcaacaattagaagatatcaaacagtcaataaataaagcaaaaatcttg
gaaaataataatgatccaatcttcatacaaaatatcaaatttaaaagagatttccttcta
aaagaatatgatacattaagtcaaatattaacaggtttaattaataaaaatttcttattg
aattataatgatattaataatattatcaatcatataatcacctctttgaatccaaatgat
tactttatcatttattatttacctgcattgtttaatgcctttaataaattagaggatatg
ccatctaatgatgttaatcttctatattcaaatttcataaaagatctgaaaaataatgat
tcgatttatgagcaaccaattaaagtcacattgattttcatctttttaacactcttcatc
gattggtgtaattcaaatccaacggtcagaacaaaggatttagatttcaaaactgatata
gattacccaatgatgttaaccgtagaattaggtgccatagaacaattattaattatcgca
gcagatacttcagaattcatgaatgatcagactttagaattaatttatgatatcagatcc
ttgttagaaacacatatccccagatttaggccaattcaattactcgacgatccagtagat
tatgagaatgcttcaaataatgataataataacaacaacactcaacatccacattcaata
acgaataatttcagttatagtgacgcgattaatactaaaaaaggcattactcccagtgaa
aataaaaacttgaaatatagcaatattgctcaatcgcagtataataatatcagactgtca
gaacaaactcaagatttccttgtttcatcatttcataatgttctacaaaaagttattacg
aattgtgccttcctattaacgaagattaaagatacggaggaagattctttactatcagaa
gctgacttgactttagatgacattgcagcaaaggcagacttagagcgtttctttataacg
atttatttcttttacgcttcaagaccaacttattcaaatgaattttggaaagataaagaa
tcaaatgcatatgggtttattgaatggtcatcaaaatgtacggatagcttaatgagatca
tgcttttatttgatgatatcaagtctatcatttggtcaagaaaattccacaaacgttttc
cattattttggtaataatagtattgtatcatggtcaaccattgtccaatgtttgaaagag
tataatttaaggattagtaacttgccaaatgtgatccaccaacgacaaaatttagagcaa
gacaccgattcatcatcgtcatcttcttccgcaacagctacaaaggaaattgattcattg
gcgatcgccttcgaagaaggtttaaacgaagaaacaacaatctttttatcatctttattg
acgcttgtcgggtcagtagcatttgacgtgcaatcagatattaagatatcattatccggt
ttattcatggatccaatctttgagtttgctaaattagaaacacctctaagtggcgcatgt
ttcaaaacactaagttatttacttccttcgtcaatagatgcaaggttaaattattggcag
tccttagattcaatattatttaaaaatgtttcattaacaaacacaacagattcttataga
tcagcatttggttatactctgaagacttttagtgaaatagtaggtttcctatctcttttc
aataatcttttgaaaataaatcctcaagatataaatgaaaatggccacttatcattcggg
aaacagaacttcccatcaaaattgggtcaagtttacagaaaaatgggtatatggccttat
tttgactatattctcaatgaaatatttgttccctctaaactaatattgaacgactttgat
agaagagctatacagactccaatattggaaataatagaaacatcgttattatcttttgat
tattctgctatattaaattcaattactcttggaataaatttggatacgctagttaatact
tcggatttctttacttacgttcaagaatctcccgcgccagttgtattcaaccatttattt
gctcaaaatgtccattctaccctctttgctatcatcgatattggtatcgaccatatatca
attgatttagagggagggaaagaccaaatgaacttactcacaagatcgatcaagataatc
aatttgattttggatttccagggaacttttactgaagaattacttccaataataattaaa
caagaaaataagagctactacataccaaaaaattttggtttacatggtttccgttccttt
tatgatactattttcttcaatttaccagtggtagcacatttaggtttatacgttggtctg
gatgatacttcgttagtgtctgaatcacttaaagttttgaaaaaattatcattgaattct
ccttcgaatggaactgatttaaatagcaagaataaattgtttacaattttcgatgcagtc
gacgattcagctcggataaaagatgcatttatttctcaattagaagtaccaattgagaat
gatggacaattatctttgaaaattcagttactgaattttatcaactccaatttatcattt
acaaagcctgctgttactgttgcccattttctattgggactacaggcatcgaatggcatt
tctttaggcccagaattaccaacatttattaactcggatgtttccttattgaattctatc
gtttccattttagaatcatcactagatatcgttacaccagaacagatacaatatgcccca
atgcgtttagcatctatttctttggaaatcattttgaaactatgccgtaatccattgacc
tcatcgttgctacttgattatttaacaaatcaacatttttttgaaaggattatggaaatt
gacgttcatattaccaaatttactcagtgggatggtaaatcttttgattctctctcaatt
gatagcggattcgactttttgcaatcagaatccattggcgcattattagcattcttatct
tataggaattatttgattcaatatttaggactattcattcatagatgttctttcatgggt
acgaagcggaatattctaacttacgtaaattttttgattaccaataaaatttattccact
agaatattctcgtttttggatagtttgaattatgaaaatcttccaatagacgaacactta
ttcaaaaactttaagtatctgaatgctttacctcttaacctcgaaaaatttacattaaat
gaaaaatgcgccggtaatatttacagcttgaatgacctgaattctttaatgagtgttgcc
caaaaagttgtcaagccacctttacacgcgacagcatgtaccacggatgaagtgggcgaa
gcacagaaagaaactttggtaaaggaaatcgtaatgatgaaattttgtgtctctagttat
ttgagcaataagaaattccaagaactacaactcttaatccttcattcttgggtacaatta
gttcaggtcatagttacagatgggaatttatcaccattatctcgttcaaattttattctg
gaagtatttgagactatcattcctaagataaatgattacgttgaagtaaatactttgttt
tcagaggaattgacatcattggctgtatttttgaacgatctttatcaaaaagaccgcatg
gtggtagacaatcttcgtttcgtcgatagtaggttgtataacatgtttaaagtgtgcttg
cacggtatcaactcaccattatcaacgcccactttgaggtctgatttttatgttttggca
aattcatatttagtaagaagaataaaggaaaacacgttggtgaaagaagttataatggat
attagaatgcataatgagaaattgcttgaggtcatttgcaatgatgcgatctatgttcaa
ggaacttgcaagataacaggtatacttttattggattccctcatccaattaggtaatata
aataaggcgaattttgttttggacaatttaatgaaaggaacccaacttcagcgtatagca
caaacgctgaaaagtacagatttattgctcacctctactgcagagcatataactatagat
gatttgttatatgaattaacagcgttcaagactacagcttcattcttagttcgtgttgct
gagacaaggattggagcccagtctttacttcaatgcaagatactacaaatcataggggat
ctttcatttttgaaaatcgatcctgatttaggatcagagctaattttcaatgagtctccc
tcaaagaattcagatttcattaaagtgaatattaatttaacaaattctatcaatggtgta
gcttctagtaatggcgtatcgctttttgaggtaataacaccaatattccgtcttctctgt
tccatactactgagcttgggcagcacaaataagtcagtaatcagcaatgtcaagaaactg
ttgatggaattccgaaagttacttgttggaattttcaagaaagatgtattgaaagaaacg
caagacacggttcagtcgacgaaatcagcttcagaagattggcaagaactagttaaattg
gccgtcgttctgtgcacactgactcaatatgacggtagggaatctagcatgctgtag

DBGET integrated database retrieval system