KEGG   Naumovozyma dairenensis: NDAI_0C03540Help
Entry
NDAI_0C03540      CDS       T02234                                 

Gene name
NDAI0C03540
Definition
hypothetical protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
ndi  Naumovozyma dairenensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(810904..815580)
Genome map
AA seq 1558 aa AA seqDB search
MPVVYGPQPLRPLNTETRHGFEEQYNSEQFIQLLMNDFIFYYDDKRFRTNGNPVLEEDKI
RDVDGYYQAIPDWKIMKDRQKTVNAALLLCLNLGVDPPDVIKTHPCARLESWVDPLDFQD
SKKAIEQIGKNLQSQYETLSLRCRYKQSLDPCVEDVKRFCNTLRRNSKTDRILFHYNGHG
VPQPTPSGEIWVFNRGYTQYIPVSLYDLQNWLGAPCVFVYDCNSAGNIVTNFQNFVQKRI
KDDEDGNHDSSAPSPTSAYQECFQLASCQVGELLLMSPELPADLFTCCLTCPIEISVRVF
LMQSPLKHSKYRIFFENTSAQKKRESLSDHSKLSNIPTVNIPGALADRRTPLGELNWIFT
AVTDTIAWTSLPRPLFIKLFRHDLMIAALFRNFLLAKRIMPWYNCHPVSDPELPNSIADH
PMWKSWDLAMDEVLGKLVSDLKNSPVNSELENQLILQQQDNFQNSKPSRQQQQQQQRSES
IQTQSRFAVGNLSTMSLVNLPGLNSRRQSTLAAVQHPQPQSHTQQQQQQQFTGFFEQNLT
AFELWLKYASNARHPPEQLPIVLQVLLSQVHRIRALVLLSRFLDLGPWAVYLSLSIGIFP
YVLKLLQSPAPELKPILVFIWARIMSIDYKNTQAELIKEKGYLYFITILVPDWGIIPQAP
LSATSSFINNGTGPITISTSINGLQNMNQQQQQQQYSLNDTTDEQKAMAVFVLASFVREF
KPGQKLCFSTQLLNKLCFYIENSDIPLLRQWSVLLVGLLYSQNPLNKFICLINYSLQTII
KSLDDPVPEVRTASILTLRYFISDLDEAEIIIRLQQEYSQQFQQLHAQMQHLQNNIQQQQ
QQQQQQQQAHQYQQFEQQQLKLEQQLNQCQMMQSQLEKIDLRKLKQQELSTLTSILPLIN
DGSPLVRKEILLYFSQVIYRYINLFIVAVFNELLEELDQLEGGHMYTDKNDVNKNAKQSI
SHGSIFSAVWKALLILMEDPYLENKMIAEKIVSYILLELSSHKELGTTFDKITHYLIKRN
ANSDINSMNFANNSQIQIGSGTYRSFQNNRKSGKKNNDMRETKSAGTYSVLSRFFSRLGF
EEQNNQNNENENVQTGLTNNGGIVGKKYSKKPRTALLATSYGVSPAVKTPYMRYDEKRMT
LPLESQFLEYACEYFHEPQMRKQESDEVGSKDYNGRLWRRNRNEKIIQETQKQKGLSLYG
NWANKFLTLDNKTQPKILRFTQFEDYLVSADDRDNITVFDWTAKKKLSRFSNGNPFGSKI
TDVKFLNEDDQTLLLTGSSDGIVKIYRDFHSIEEIKLISACRALTDMLLTPRSSGLLTEW
QQIRGSLLATGDVKIIRIWDAHTETVEVDIPAKTSSLITSLTSDQLAGDIFTAGFADGTL
RVYDRRMDPRDSMVRRWRAGDGSQGAWINNVQLQRGGYRELVSSTTNCVVQLWDMRSEDP
VLTFIDEDTNHGTQKKNTTLTCMQVHEHAPVIATGTKQIKIWTTSGDLLSSFKNNHYMGS
GMANTLVATGIGASLSYSSTSGTFLSSLAFHPHRMMLAANNSHDTNITIYNCEGQRGR
NT seq 4677 nt NT seq  +upstreamnt  +downstreamnt
atgccagtggtttatggaccacagccattacggcctttgaatactgaaacaagacatgga
tttgaagaacaatataatagtgaacaattcatacaattgttgatgaatgattttattttc
tactatgatgataaaagatttagaacaaatgggaaccctgtcctagaagaagataagata
cgggatgttgatggatattatcaagctatcccagattggaagataatgaaagatagacaa
aagacagtcaatgcagcattactattatgtctgaatcttggagtagaccctcctgacgtg
attaaaacacatccatgtgcaagattagagtcatgggtggatccattggatttccaagat
tccaaaaaagctatcgaacaaatagggaagaatttgcaatcacaatacgaaacattatcc
ctaagatgtagatataaacaaagtttagatccgtgcgtggaagacgtgaaaagattttgt
aatactttgagaagaaattcaaaaactgatcgtattttattccattataatggccatgga
gttcctcaacctactccatcgggtgaaatttgggtatttaacagaggatatacacaatat
atacctgtttcactctatgatctacaaaattggctaggcgcaccatgcgtcttcgtctat
gactgtaatagtgcagggaacatcgttacaaatttccaaaatttcgttcaaaaaaggatc
aaagatgatgaagatgggaatcatgactcttcagcaccatctcctacatcagcttatcaa
gaatgtttccaattagcgtcatgtcaagtaggagaactactattaatgagtccggaactt
ccagcagacttattcacttgttgtttaacatgccccattgaaattagtgtcagagtcttc
ctaatgcaatcccctttgaaacactctaaatataggattttcttcgaaaacacatcagct
cagaaaaaaagggagtcattatctgaccattcgaaattatctaatattccaactgtgaat
atacctggcgcattagctgatagaagaacacctttgggtgaactaaattggatctttacc
gcagtcacagacactatcgcatggacatcactgccgagaccattattcattaaactattt
agacatgacctaatgatcgctgcgttattccggaattttttattggctaaaagaattatg
ccatggtacaattgccatccagtgtcggaccctgaattaccaaattctatagcagatcac
cccatgtggaaatcttgggatcttgcaatggatgaagtacttgggaaattagtttctgat
ttgaaaaattcacccgttaactcagagttggagaatcaattgatcttgcaacaacaagac
aacttccaaaattcaaaaccttctcggcagcagcaacaacaacaacaaaggtcagaaagt
atacaaacacaatcgagattcgcagtagggaatttgagtactatgtccttggttaacctt
ccaggattaaattcgagaaggcaatctactcttgcagcagtacaacacccgcaaccacaa
tcacacacacaacaacaacaacaacaacaatttacaggatttttcgaacaaaatctaaca
gcttttgaactttggttgaaatatgcatctaatgctaggcatccaccagaacaactgcct
atcgttttacaggtcttactttctcaagtacatcgtattagagcattagtacttctatcc
aggttcttagatttaggtccctgggctgtttacctctctttatcaattggtatcttccca
tatgttttaaagcttctacaaagtccagcacctgaactgaaaccaatcttagttttcata
tgggcaagaattatgtcaatcgattataaaaatacacaagctgaacttatcaaagaaaaa
ggttatttatatttcattacaatcttagttcctgactggggtatcataccgcaagcgcca
ttaagtgctacatcttcatttattaataatggcactggaccaataacaatatctacttca
atcaatggcttacaaaatatgaatcaacaacaacaacaacaacaatattctttaaacgat
accactgatgagcagaaagccatggcagtgtttgtattggcatcctttgtacgagagttt
aaaccaggccaaaaattatgctttagtactcaattattgaataaactttgtttttacatt
gaaaactctgacattccactgttgagacaatggagtgtcttactcgtaggtttattatat
tcacaaaatccattgaataaatttatttgtctcatcaattattctctacaaactattatt
aaatcattagatgatcctgtaccggaagttagaacagcttctattttaactttaagatat
tttatatctgatttagatgaagctgagataattattcggcttcaacaagaatattcacaa
caattccaacaattacatgcccaaatgcaacatttacaaaataatatacaacagcaacag
cagcaacaacaacagcaacaacaagcacatcaataccaacaatttgagcaacaacaatta
aaactcgaacaacaattgaatcaatgccaaatgatgcaatcacaactagaaaagattgat
cttaggaaattgaaacaacaagaattgtcaactttgacatctatcttaccattaatcaat
gatggttctccactagtaagaaaagaaatcctgctatatttctcacaggttatctacaga
tatatcaatcttttcattgtcgctgtctttaatgagttattagaggaattagatcaatta
gaaggtggtcatatgtacaccgataagaatgatgtgaataaaaatgcaaaacagtcaatt
agccacggttcaattttttcagcggtttggaaggcattattgatccttatggaagatccc
tacctggaaaataaaatgatcgcggaaaaaattgtttcttatatattattagaactaagc
tctcataaagaactgggaacaacattcgataaaattacacattatttgattaagagaaat
gcaaattctgacataaatagtatgaattttgcaaataattcacaaattcaaataggaagt
ggaacttaccggtcgtttcaaaataataggaaatcaggtaagaaaaataatgatatgcga
gaaacaaaaagtgccggtacctattctgttctttcgaggtttttcagtagattgggcttt
gaagagcagaataaccagaataatgaaaatgaaaatgtacaaacgggacttacaaataat
ggtggtatagttggtaaaaaatatagtaaaaaaccaagaacagctttattagcaacatcc
tatggtgtgtccccagctgtaaaaacaccatacatgagatatgatgaaaagagaatgact
ttgcccctagaaagtcagtttttggaatacgcatgcgaatattttcacgaacctcaaatg
agaaagcaagaatctgatgaggtcggaagcaaagattataatggaagactttggagaaga
aatagaaatgaaaaaattattcaagaaacacaaaaacaaaagggattatcattatatggt
aattgggcaaataaatttttaactttagacaacaaaacacaaccgaagattttacgtttt
acgcaattcgaagattatttggtttcagctgatgatagagataatattactgtttttgac
tggactgcaaagaaaaagctatcgagattttcgaacggtaacccatttggttcaaaaatt
accgacgttaaatttttgaatgaagatgatcaaacacttttattgacaggttcttcggat
ggtattgttaaaatatatagagatttccattctattgaggaaattaaattgatttctgca
tgtagagcacttacagatatgttgctgactccaaggtctagtggattattaacagaatgg
caacaaattaggggttctttattggcaactggggatgtaaaaataattaggatctgggat
gcccatacggaaactgtggaagtcgatattcctgctaaaacatcttctttgattacctct
ttaacatcggaccagttagcaggtgacatatttacagctggttttgcagatgggacgtta
agggtttatgatcgtcgtatggatccgagggactcaatggtgcgtcgttggagagcaggc
gatgggtctcagggggcatggatcaataatgtccaattacaaagaggtggttatagggaa
ttagttagtagcaccacaaattgtgtggtacaattatgggatatgagatcagaagatcct
gtactgacttttatagatgaagacactaatcatggcacccagaagaaaaatacgacgtta
acctgtatgcaagttcatgagcatgctcccgtcatcgcaactggaacaaaacaaattaaa
atatggactacatccggtgatttgctgtcatcttttaagaataaccactatatgggtagc
ggtatggccaatacgctagttgcaacaggtatcggtgcctctttatcttactcctctaca
tcaggcacattcttgtcgtcattagcattccaccctcataggatgatgctggctgccaat
aattcgcacgatacaaatataacaatatacaattgtgaagggcaaagaggaagataa

DBGET integrated database retrieval system