KEGG   Naumovozyma dairenensis: NDAI_0C03830Help
Entry
NDAI_0C03830      CDS       T02234                                 

Gene name
NDAI0C03830
Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
ndi  Naumovozyma dairenensis
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ndi00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(873163..874068)
Genome map
AA seq 301 aa AA seqDB search
MGLCCLSSSTPGFIPMVLGALLVGFSIYYFIRRHGLYLQKTNYVLKGDGAWEEVTLYKVQ
KEAHNVKRFIFKLPEDMTLGLPLCGNILTKFVTEKGYNVVRPYTPISDIHAKGSFELCIK
RYPDGKMGTHMHSLKPGDKLSIKGPIKKWPWKPNQFKEITLLGAGSGTTPLYQLASHVVK
NRKDKTKVNVYYGNKTVGDILLKKEWKELEEQHPGQINVQFFVNEVSGEGKDKFNGHVGF
ITKDYIKNHAAGPDQKTHIFICGPSGFMKAFSGEKSNSKEQGPLTGILKELGYSADQVFK
Y
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgggtctttgttgcttatcaagttccacaccaggatttataccaatggtactaggagct
ctgctcgtaggtttttctatttactactttattcgtagacatgggctttatctccagaaa
accaactatgtattgaaaggtgatggagcatgggaagaggtcacactgtataaagtccaa
aaagaagcacataatgtcaaaagatttatcttcaaattacctgaagatatgactctaggt
ttgccattatgtggtaatattttaactaagtttgttacagagaagggttacaatgttgtt
agaccatatacaccaattagtgacatacacgcgaagggttcttttgaattatgtatcaag
cgttatccagatgggaaaatgggtactcatatgcattcattaaagccaggagataaactt
tcaattaaaggacctatcaagaaatggccatggaaaccaaatcaattcaaggagattact
ttattaggtgcaggttctggtaccactccattgtatcaattagcttctcatgttgttaag
aaccgtaaggataagacgaaagttaatgtttattatggtaataagactgtaggtgatatt
cttttgaaaaaggaatggaaagagttagaagaacagcatccaggccaaattaatgttcaa
ttctttgttaatgaagtctctggtgaaggaaaggacaaatttaacggtcatgtgggattc
attactaaggactacatcaaaaaccatgccgcaggtccagatcaaaagactcatattttc
atttgtggaccatcagggtttatgaaagcattttctggggaaaagtcaaattcaaaggag
caaggtccattaacaggtatcttaaaggagttgggttactctgcagatcaagtcttcaaa
tattga

DBGET integrated database retrieval system