KEGG   Naumovozyma dairenensis: NDAI_0C03830Help
Entry
NDAI_0C03830      CDS       T02234                                 

Gene name
NDAI0C03830
Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
ndi  Naumovozyma dairenensis
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    NDAI_0C03830 (NDAI0C03830)
Enzymes [BR:ndi01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     NDAI_0C03830 (NDAI0C03830)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(873163..874068)
Genome map
AA seq 301 aa AA seqDB search
MGLCCLSSSTPGFIPMVLGALLVGFSIYYFIRRHGLYLQKTNYVLKGDGAWEEVTLYKVQ
KEAHNVKRFIFKLPEDMTLGLPLCGNILTKFVTEKGYNVVRPYTPISDIHAKGSFELCIK
RYPDGKMGTHMHSLKPGDKLSIKGPIKKWPWKPNQFKEITLLGAGSGTTPLYQLASHVVK
NRKDKTKVNVYYGNKTVGDILLKKEWKELEEQHPGQINVQFFVNEVSGEGKDKFNGHVGF
ITKDYIKNHAAGPDQKTHIFICGPSGFMKAFSGEKSNSKEQGPLTGILKELGYSADQVFK
Y
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgggtctttgttgcttatcaagttccacaccaggatttataccaatggtactaggagct
ctgctcgtaggtttttctatttactactttattcgtagacatgggctttatctccagaaa
accaactatgtattgaaaggtgatggagcatgggaagaggtcacactgtataaagtccaa
aaagaagcacataatgtcaaaagatttatcttcaaattacctgaagatatgactctaggt
ttgccattatgtggtaatattttaactaagtttgttacagagaagggttacaatgttgtt
agaccatatacaccaattagtgacatacacgcgaagggttcttttgaattatgtatcaag
cgttatccagatgggaaaatgggtactcatatgcattcattaaagccaggagataaactt
tcaattaaaggacctatcaagaaatggccatggaaaccaaatcaattcaaggagattact
ttattaggtgcaggttctggtaccactccattgtatcaattagcttctcatgttgttaag
aaccgtaaggataagacgaaagttaatgtttattatggtaataagactgtaggtgatatt
cttttgaaaaaggaatggaaagagttagaagaacagcatccaggccaaattaatgttcaa
ttctttgttaatgaagtctctggtgaaggaaaggacaaatttaacggtcatgtgggattc
attactaaggactacatcaaaaaccatgccgcaggtccagatcaaaagactcatattttc
atttgtggaccatcagggtttatgaaagcattttctggggaaaagtcaaattcaaaggag
caaggtccattaacaggtatcttaaaggagttgggttactctgcagatcaagtcttcaaa
tattga

DBGET integrated database retrieval system