KEGG   Naumovozyma dairenensis: NDAI_0C03840Help
Entry
NDAI_0C03840      CDS       T02234                                 

Gene name
NDAI0C03840
Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
ndi  Naumovozyma dairenensis
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    NDAI_0C03840 (NDAI0C03840)
Enzymes [BR:ndi01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     NDAI_0C03840 (NDAI0C03840)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(875020..875817)
Genome map
AA seq 265 aa AA seqDB search
MSLRSRSTSRYIPVAIGAVAVAISAYYLARKRGSLIGPEVVLKGDGQWVDIPLYKIEKES
HDVDRLIFKLPKEDAVLGLPLCGAVFAKYVTEKGNNVVRPYTPISDIHAKGFFELCIKKY
PGGKMSGRMHSLKPGDTMTFKGPIKKWQWEPNSFEEITLLAAGTGTTPLYQLASHIAKNP
KDTTKVNIFYGNKTPGDILLKKEWKELEEKYPDQINVQCFVDEVRDAEKDNFKGHIGFIT
KEFIEKMHQALIKTRIFSFVDHQDL
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtctttacgttcgaggtctacatcaaggtatataccagttgcaataggtgcagttgca
gtagctatttctgcttactacttagctcgtaagagaggatctctcattggacctgaagtt
gtattgaaaggtgatggacaatgggtagatataccactctacaagatcgaaaaagaatcc
cacgacgttgatagattgatattcaaattacctaaagaagatgccgtcttaggtttacca
ctatgtggtgcagttttcgctaaatatgtcacagagaaggggaataatgtggttagacca
tatactcccattagtgacatacatgcaaagggatttttcgaattgtgtatcaagaaatat
ccaggtgggaaaatgagtggccgtatgcattcattgaaaccaggtgatacaatgacattt
aagggccctatcaagaaatggcaatgggaaccaaattcctttgaggaaatcacattactc
gctgctggtactggtaccactccattgtatcaattagcttctcatattgcaaaaaaccct
aaagatacgactaaagtcaacatcttttatggtaataagactcctggagatattctatta
aaaaaggaatggaaagagttggaagaaaagtatccagatcaaattaatgtgcaatgtttt
gtcgatgaagtccgcgatgcagaaaaggacaacttcaaaggccatattggattcattacc
aaagaatttattgaaaaaatgcaccaggccctgataaaaacacgcatattttcgtttgtg
gaccatcaggatttatga

DBGET integrated database retrieval system