KEGG   Naumovozyma dairenensis: NDAI_0C03940Help
Entry
NDAI_0C03940      CDS       T02234                                 

Gene name
NDAI0C03940
Definition
hypothetical protein
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
ndi  Naumovozyma dairenensis
Brite
Enzymes [BR:ndi01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     NDAI_0C03940 (NDAI0C03940)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(896084..898120)
Genome map
AA seq 678 aa AA seqDB search
MNSTDLLTVAVICILFFIYKKWDVIKELIFSNDDHISAVNSGSRDIVQVVLENNKNYLVL
FGSQTGTAEDYAKKFSKELSSKFNLNVLCADLELYDYDTLSELPNNVLVSIFMSTYGEGD
FPDGAIPFETFLTTTGENSLTNLNFSIFGLGNSTYEFYNGAARKVLKYLQSAGGNLLGSI
GEGDDATGSTDEDYLTWKESIMAELKNKLHLEEQEHKFKSTFKYETLPEINSHVSLGEPT
SKYLPSEPAFTGPFTAAQPFIAPIIKSHELFTSVERNCIHSEFDISSSNISYSTGDHLGI
WPSNATEKVQQFLNVFNLNPDTIFNLVSQDKTIKVPFPCPTTVGAVIRHYLEITGPVSRQ
FFEHLIQFAPNSSIKEKLTKLAKDKDAFQQEITSKYFNLADALLYLSGGSKWESIPWEFL
IENIPKLQPRYYSISSSSLSERNTIHVTSVVENTPNPKTGSNIVGVTTNLLRNIQLAQNK
QLQSTEINPLPVHYDLNGPRDLFANYKLPVHVRQSTFRLPQNIETPVIMIGPGTGVAPFR
GFIRERVAQVEKDNSIKLGKHILFYGCRNEQDYLYQEEWSKYATVLGESFEMNVAFSRVP
GTKKVYVQDKLNEMSSDIWDLLKKGAYIYVCGDAGRMAKDVSRTFINILQKGHGINEAEA
LEMVKALKTAGKYQEDVW
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atgaacagtacagacttacttacagttgcagttatctgtatattgtttttcatctataaa
aaatgggacgttataaaggaactcattttttctaatgacgaccatatatcggctgtcaat
tccggttctagagatattgtacaagtggtattagaaaataataaaaactatttagtccta
tttggttcacaaacaggtaccgctgaagattatgccaagaaattttctaaagaattatca
tccaaatttaatctgaatgtattatgtgcggacttggaactttatgattatgacactcta
agtgaattaccaaataacgtcttggtttccatatttatgtccacttatggcgaaggtgat
ttccccgatggcgccattccatttgaaacgtttcttacaactaccggcgaaaattcatta
acaaacttgaactttagtatttttggtttaggtaactccacttatgaattctataatggt
gctgcaagaaaagtcttgaaatatttacaaagtgctggtggtaatttgctcggtagtatt
ggagaaggtgatgatgctactggttccaccgatgaagattatctaacttggaaagaaagt
attatggccgaattgaaaaataaactgcatctggaagaacaagaacataaattcaaatct
actttcaaatatgaaacgttacctgaaattaattctcatgtttccttaggtgaaccaact
tctaagtatttacctagtgaaccagcatttacaggtccattcactgctgcacaaccattt
attgcaccaattataaaatctcacgaattattcacgtccgttgaacgtaattgtatccat
tctgaatttgatatttccagttctaacatttcatattccaccggtgaccatttaggtatt
tggccatctaatgctactgaaaaagtacaacaatttttgaatgtctttaacttgaatcca
gatacaattttcaatttggtatcccaagataagactatcaaggttccctttccatgccca
acaaccgtcggtgctgttattagacattatttagagattacaggtcctgtgtcaagacag
tttttcgaacatttaatccaatttgcaccaaatagttccatcaaggaaaaattgaccaaa
ctagctaaagataaagatgcattccaacaagaaatcacatccaaatatttcaatcttgca
gacgctttattatacttgtctggcggttccaaatgggaaagcattccatgggaattctta
attgaaaatattccaaaattacaaccacgttattactccatttcatcatcctcattatca
gaaaggaataccatccatgtcacatcagttgttgaaaatacaccaaatccaaaaacaggt
tctaatattgttggtgtcactactaatttattgaggaatattcaattggctcaaaataag
caattacaatctactgaaataaatccattgcccgttcattatgatttaaatggaccaaga
gatttatttgccaattataagttaccagtccatgtccgtcaatcaacatttagattacct
cagaacattgagactccagtaattatgatcggaccagggacaggtgtagcacccttccgt
gggtttattagagaacgtgttgcgcaagtggaaaaggataatagtatcaaattaggtaaa
catatattgttctatggttgtagaaacgagcaagattatttatatcaagaagaatggtct
aaatatgctactgttttgggtgaatcatttgaaatgaacgttgcattttctagagtaccg
ggtactaaaaaagtttatgtgcaagataaattaaatgagatgtcttctgatatttgggat
ttattaaagaagggcgcctatatttatgtatgtggtgacgcgggtagaatggctaaagat
gttagtcgtacttttattaatatattacaaaaaggccatggcatcaatgaagctgaagct
ttagaaatggttaaggcattgaaaacggcagggaaataccaagaagatgtctggtag

DBGET integrated database retrieval system