KEGG   Naumovozyma dairenensis: NDAI_0C04120Help
Entry
NDAI_0C04120      CDS       T02234                                 

Gene name
NDAI0C04120
Definition
hypothetical protein
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
ndi  Naumovozyma dairenensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NDAI_0C04120 (NDAI0C04120)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    NDAI_0C04120 (NDAI0C04120)
Enzymes [BR:ndi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     NDAI_0C04120 (NDAI0C04120)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(937489..938775)
Genome map
AA seq 428 aa AA seqDB search
MTMNKTYTLVIKLGSSSLVDEKTKEPKLAIMSLIVETVVKLRRLGHKVIIVSSGGIAVGL
KTLNLDKRPKHLAEVQAIAAVGQGRLIGRWDLLFSQFNQRIAQILITRNDIVDWTQYKNA
QNTINELLKMGVVPIVNENDTLSISEIKFGXNDTLSAITSALVGADYLFLLTDVDCLYTD
NPRTNPDAKPILVVPDLTKGLPGVTTTNGAGSDVGTGGMETKLIAADLATNAGVHTIIMK
SDVPANILKIVEYMQTLDLDGDSRKLKFGTTNIDLAALQEKELTKLNSLNVPLHTKFIAN
DNLHHLKNREFWILHGLVTRGSIIIDQGAYNALTRKNKAGLLPVGIIDIEGTFHELECVD
LKLGKKLENGELDPSVPLVTVGRARCNYTSIELSKIKGLQSDQIEDVLGYADSEYAAHRE
NLAFPPHT
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgacaatgaataaaacatacacgttagtgatcaagttaggttcatcctccttagtggat
gaaaagaccaaagaaccaaaactggcaatcatgtccctaatagtggaaacagtagtgaaa
ttaagacgtttaggtcacaaagtcatcattgtttccagtggtggtatcgctgttggatta
aagactctaaatttggataaaagaccaaaacatctggctgaagtacaagctatcgctgct
gtcggtcaaggtaggttgattggtagatgggatcttttattctctcaatttaatcaacgg
atcgctcaaattcttatcacgagaaatgatatcgttgattggactcaatataagaatgct
cagaatactattaatgaattgttgaaaatgggggttgtaccaatcgttaatgaaaatgat
acgttgtctattagtgagattaaatttggagntaatgatactttgtcagcaattacttcc
gcattggtcggcgcagattatttgttcttgttaactgatgtggattgtctgtataccgat
aatccaagaacaaatccagatgctaaacctatattggttgtaccagatttaacaaaggga
ttaccaggtgttactacgacaaatggcgctggttcagatgtcggcactggtggtatggaa
accaaattgatagcagcggatctggctaccaatgccggggtacatacaattattatgaag
agtgacgttcctgctaatatattgaaaattgttgaatatatgcaaactttagatttggat
ggagatagtaggaaattgaaatttggtaccactaacatagatttagctgctcttcaagaa
aaggaattgacgaaactaaattctttaaatgtcccattgcatactaaattcattgctaat
gataatttacatcatttgaaaaacagagaattttggatactgcacggtcttgtcacaaga
ggttctatcattattgatcaaggtgcatataatgctttgacacgtaaaaataaagctgga
ttattacctgtcggaatcattgatatagaaggaactttccatgaactagaatgtgttgat
ttgaaattaggtaaaaaattagaaaatggggaattagatccatctgttcctctagtaact
gttggtagagctagatgtaattatacaagtatcgaattaagcaagattaaaggtttacaa
agtgatcaaattgaagatgtactaggttatgctgatagtgaatatgcagctcatagagaa
aacttagcatttcctcctcatacataa

DBGET integrated database retrieval system