KEGG   Naumovozyma dairenensis: NDAI_0C04930Help
Entry
NDAI_0C04930      CDS       T02234                                 

Gene name
NDAI0C04930
Definition
hypothetical protein
Orthology
K11252  
histone H2B
Organism
ndi  Naumovozyma dairenensis
Brite
Exosome [BR:ndi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   NDAI_0C04930 (NDAI0C04930)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(1143497..1143898)
Genome map
AA seq 133 aa AA seqDB search
MSSKAEKKPAASKAPAEKKPAAKKTSTATEGIKKRTKVRKETYSSYIYKVLKQTHPDTGI
SQKSMSILNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEG
TRAVTKYSSTTQA
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgtcatctaaagccgaaaagaaacctgctgcttctaaagctccagctgaaaagaaacca
gccgccaagaaaacttctactgccactgaaggtattaaaaagagaactaaagtcagaaag
gaaacatattcttcatacatttacaaagtcttaaagcaaacacatccagatacaggtatt
tctcaaaaatcaatgtctatcctaaattcattcgttaatgatatctttgaaagaattgcc
acagaagcttctaaattggctgcttataacaagaaatctaccatatcagctagagaaatt
caaactgctgttagattgatcttacctggtgaattggccaaacatgctgtctctgaaggt
actagagctgttactaaatattcttccactactcaagcttaa

DBGET integrated database retrieval system