KEGG   Naumovozyma dairenensis: NDAI_0C05260Help
Entry
NDAI_0C05260      CDS       T02234                                 

Gene name
NDAI0C05260
Definition
hypothetical protein
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
ndi  Naumovozyma dairenensis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ndi00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(1219267..1220940)
Genome map
AA seq 557 aa AA seqDB search
MLIKLTEENVSLIRNSPPRKNLRRPKRKAIISSITITIVAITIILFYGFNNNSSSSSSSF
PKHPNKKNVILFITDGMGPASLSLTRSYRQFIENLPINDTLTLDNHLIGSSRTRSSDSLI
TDSAAGATAFSCILKTKNNAVGVNDQYEPCGTLLEAAKLDGLMTGLVVTTRITDATPAAF
SAHSNSRFQEDLIALHQLGKHNNLGRVVDLMIGGGRSHFHGKDDGGVRIDGRNLIDEAIN
DGWNYIDDRETFDSLQLGKNVSFPLLALLAENDIPFDLDRNPEEYPSLQEQAITAVNALV
EATKDSDKGFFLMIEGSRIDHAGHENDPAAQVREVLAFDKAFQSVLELVDEMDTETIVLS
TSDHETGGLVTARQVTKTYPEYVWYPLYLQNAKHSGEFLKSKILSFEGTLDDKKLFIEKK
ILQDILQIDDYNNDDVNALAEMNNLDDIQYKLNDMVSFRAQIGWTTHGHSAVDVNIYGYA
NTKSSWYHILDHLQGNHENLEIGEFIRQYLNLDLKDVTKRIKNVKTKLYDLEKIQEIEET
DDEYHHLAHQILKAKQL
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgcttattaaattaacagaagaaaatgtttctctgataagaaattcaccacccaggaag
aacttgagaagacccaaaaggaaggcaataatctcatccataaccatcacaatagtagca
ataacaattatcctattttatggcttcaacaacaactcatcttcctcttcctcctcattt
ccaaaacatcccaacaagaaaaatgtaatattattcataacagacggtatgggtccagca
tcattatccctcactagatcatacaggcaattcatagaaaacttaccaataaacgataca
ttaaccctcgacaatcatttaataggatcttccagaacaagatcctcagactcattaatc
accgattcagcagcaggtgccaccgcattcagttgtatcttaaagactaaaaacaacgct
gttggagtaaatgatcaatatgaaccatgtgggacccttttggaagctgctaaattggat
ggacttatgacggggttggtggtcactacgagaattactgatgcaactcctgctgcgttt
agtgctcattctaattcaaggtttcaagaagatttgattgcgttacatcaactggggaaa
cataataacttgggtagagtcgtggatttgatgattggtggtgggagatcacatttccat
ggtaaagatgatggtggtgttagaatcgatggtagaaatttgattgatgaagcaattaat
gatggttggaattatattgacgatagggagacatttgattctttgcaattaggtaaaaat
gttagtttcccattgttggctttattggcagaaaatgatattccatttgatttggataga
aatcctgaagaatatccttctttgcaagaacaagctattactgctgtgaatgctttggtt
gaagccacaaaggattctgataaggggttcttcttgatgatcgaaggttccagaattgat
catgctggtcatgaaaatgatccagctgcacaggttagagaagttctggctttcgataag
gcattccaaagcgtcttggaattagtagatgaaatggatacagagactatcgttttatct
acttctgaccacgaaactggtggattagtcaccgcaagacaagttacgaaaacttatcct
gaatatgtttggtatccactttatttacaaaacgcaaaacattctggtgaatttttaaaa
tctaaaattttatcatttgaaggtactttagatgataagaaattatttatcgaaaagaaa
atattacaagatattttacaaattgatgactataataatgatgacgttaacgcattggct
gaaatgaataacttagatgatattcaatataaattgaatgatatggtttcatttagagcc
caaattggttggactacccatggtcatagtgctgttgatgttaatatttatggctatgcc
aatacaaaatcttcttggtatcatatcctggatcatttgcaaggtaatcatgaaaatttg
gaaattggtgaattcataaggcaatatttgaatttagatttaaaagatgtcactaaacgt
attaaaaatgttaaaactaaattgtatgacttggaaaaaattcaagaaattgaagaaact
gacgatgaatatcaccatttggcacatcaaattttgaaagcaaagcaattgtaa

DBGET integrated database retrieval system