KEGG   Naumovozyma dairenensis: NDAI_0C05630Help
Entry
NDAI_0C05630      CDS       T02234                                 

Gene name
NDAI0C05630
Definition
hypothetical protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
ndi  Naumovozyma dairenensis
Brite
Enzymes [BR:ndi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     NDAI_0C05630 (NDAI0C05630)
Transfer RNA biogenesis [BR:ndi03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    NDAI_0C05630 (NDAI0C05630)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:1300874..1302556
Genome map
AA seq 560 aa AA seqDB search
MARHGKGPKTNKQNLAPEKERFIQCCSDVTLELTNSLTSNTTREINLNGLITKYSKKYKL
KQQPRLTDIINTIPDQYKKYLLPKLKAKPVRTASGIAVVAVMCKPHRCPHIAYTGNICVY
CPGGPDSDFEYSSQSYTGYEPTSMRAIRARYDPYEQARGRVEQLKQLGHSIDKVEYVVMG
GTFMSLPNDYREDFITKLHNALSGFNGNDLDEAIKYSQQSLTKCVGITIETRPDYCTQTH
LDDMLRYGCTRLEIGVQSLYEDVARDTNRGHTVKAVAEIFAISKDAGYKVVSHMMPDLPN
VGMERDIEQFKEYFENPDFRTDGLKIYPTLVIRGTGLYELWKSGKYKSYNSNALVDLVAR
IMALVPPWTRIYRVQRDIPMPLVTSGVDNGNLRELALARMKDLGTSCRDIRTREVGIQEV
HHKVQPDQVELIRRDYYANGGWETFLSYEDPKKDILIGLLRLRKASKKYTYRKEFTSQRT
SIVRELHVYGSVVPLHSRDPRKFQHQGFGTLLMEEAERIAREEHGSEKISVISGVGVRNY
YAKLGYELDGPYMSKKIEVD
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtcacggtaaaggtcctaagaccaacaaacaaaacctagctccagaaaaggaa
cgtttcatccaatgttgttccgatgtcaccttagaattaaccaactcattgacctccaac
accacgagagaaataaatctaaatggtctaatcactaaatattccaagaaatacaaacta
aagcaacaaccaagactaacagacatcatcaacacgatccctgaccaatacaagaaatac
ctcttaccaaaactaaaggctaaaccagtgagaactgcctcaggtatcgctgtcgtcgca
gtcatgtgtaaaccacatcgttgtcctcacatcgcatacacaggtaacatttgtgtctac
tgtcccggtggtcccgattctgattttgaatattcatctcaatcatacacaggatatgaa
ccaacttcgatgcgtgccattagagctcgttatgatccctatgaacaggctcgtgggaga
gtagaacaattaaaacaactaggacattccattgataaagtcgaatatgtcgtcatgggt
ggtacgttcatgtcgttgcctaatgattatagagaggattttattactaagttacataat
gctttatctgggtttaatgggaatgatttggatgaagctattaaatattcccagcaaagt
ttgactaagtgtgttgggatcactattgaaaccagacccgattattgtactcagactcat
ttggatgacatgttgaggtatggttgtactagattggaaatcggggttcaatcattgtat
gaagatgtcgctcgtgatactaatagaggtcacactgtgaaggctgtcgctgaaattttc
gccatttcgaaagatgccggttataaagttgtgtctcacatgatgcctgatttacctaat
gttgggatggaaagagatattgaacaatttaaagaatatttcgaaaatccagattttaga
actgatgggttgaaaatttatccaactttggttattagaggtacaggtctatatgaactt
tggaaatctggtaaatataaatcatataattcgaatgcacttgttgatttggtggcaaga
attatggctttggtacctccttggactagaatttatcgtgttcaaagagatattccaatg
ccgctagttacatctggtgtcgataatggtaatttgagagaattggccttagcaagaatg
aaggatttaggtacttcttgtagagatattcgtactagagaagttggtattcaagaagtg
catcataaagtccaaccagatcaagtcgaattgatcagaagagattattatgctaatggt
ggatgggagactttcttatcctacgaagatccaaagaaagatattttgatcggtctgttg
agattaagaaaggcatcaaaaaagtacacgtatagaaaggaattcacttctcaaaggacg
tccattgttagagaattacacgtctatggttcggtggttcccttacactcaagagatcca
agaaagttccaacatcaaggttttggtactttattgatggaagaagctgaaagaattgct
cgtgaagaacatggatccgagaagatttcagttatttccggtgttggtgtcagaaactat
tacgctaagttgggctatgagttagatggaccttacatgtcaaagaagattgaagttgat
taa

DBGET integrated database retrieval system