KEGG   Naumovozyma dairenensis: NDAI_0C05900Help
Entry
NDAI_0C05900      CDS       T02234                                 

Gene name
NDAI0C05900
Definition
hypothetical protein
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
ndi  Naumovozyma dairenensis
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    NDAI_0C05900 (NDAI0C05900)
Enzymes [BR:ndi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     NDAI_0C05900 (NDAI0C05900)
Peptidases [BR:ndi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   NDAI_0C05900 (NDAI0C05900)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(1350639..1353119)
Genome map
AA seq 826 aa AA seqDB search
MLNSSNAKNPTDSNPNIKRLNELVSKFVKDDDLNATLDVMLQEGVELLQNYRLECEKLDN
FKTKDEYQFHDVYRTSESAYLYFNILYQLIFKRIPITNEFRISLNSPSSDHSTRLLQIYS
TLKKTVQEDRRIQEIETFLAKFSTAYELENKFPKSKTIHQVTNLSDSFILPEKLHDLLSS
HKRNLLLIDVRTRKEFDTLHIDAPIILPIGPLSFKSTFTDLQIEQTSLLTSTFQERNYFK
KRNQFRYIVLYTKDDNDTTYYYTQVISLFNILTIAASKRNIDQICPSIFILKGGITSWVQ
HSYECKTNLTGKTANQYNQNLFKRSKDSSIYKHVALSDNSLNEGSKTCNPIVPASVQTVI
PNFIPPSHSKSTICLMKNEQPQALYNHQVIPNLIHRAPLDTESNNTQNVPMGFKNPIPQM
YEIPKYNPSVNSGPKLPLLPPTANPQQIVPKLDLDFTTGLENVKNSCYMNCVIQCLLSTH
DLTKLYLTNAFLTQINVENKLGSKGFLSKNFANLIQTMYKKSAFQPYNPNFLHPVAPLEF
KNACGMMNSIYAESTEQDCQEFCEFLLDGLHEDLNQCSGNPRPKELSANEAELRESLSMR
IASEIEWESFLTTNFSPIINLFQGQYASRLQCLICQHTSTTYQPFSLLSIPVPSMVFSNG
QTCNILDCFKEFTKCERLDNDEKWFCPKCRRKQISTKQLKITRLPKNLIIHFKRFDNFMN
KNNIFVQYPYQLDLTSLWVNDYDGKLPPNFNEPPPSRGQTPPFKYKLNAVSCHSGNLGSG
HYTAYVDKGLYRGWFRFDDASYRPVKFGTEFLTPDAYLLFYQRIYE
NT seq 2481 nt NT seq  +upstreamnt  +downstreamnt
atgctaaacagtagtaatgcgaagaatcctactgactccaatccgaatattaaaagatta
aatgaactcgttagtaaatttgtaaaggatgatgacttaaatgcaacgttagatgtgatg
ctacaggaaggtgtggaactattacaaaattatcgactcgaatgtgagaagttagataat
ttcaaaactaaggatgaataccaatttcatgacgtttatcgtacgagcgaatctgcttat
ctgtatttcaatatcttataccagttaatctttaaacgaatccctataactaatgaattc
agaataagtctcaatagtccatcaagcgatcacagtactagacttcttcaaatatactcc
actttaaagaaaacagttcaagaagatcgtagaatccaagaaattgaaacgttcttagcc
aaattttcaacagcttacgaattggagaacaagttccccaaatctaaaactatccatcaa
gtgacaaatttatcagactcatttatattacctgagaaactccatgatttactttcatca
cataaaagaaatctgttattaattgatgtccgaacaaggaaagaattcgacacattacat
attgatgctccaattatccttccaattggaccgttgtcatttaaaagtacatttactgac
cttcaaattgaacaaacttctctcttaacgtctacatttcaagaacgaaattattttaag
aaaagaaatcaatttagatatatcgttctgtatacgaaagatgataacgacactacatat
tattatacacaagtgatttcattgtttaatatcctcacaattgctgcatcaaagagaaac
atagaccagatatgcccatccatatttatcctaaaagggggtataacaagttgggttcaa
cactcttatgaatgtaaaacaaatttaacaggtaaaactgcaaatcagtataatcaaaat
ttatttaagagatccaaagattccagcatatataagcatgtagcgttatcggataactct
ttgaatgaaggatcgaaaacatgtaatccaatagtaccagccagcgtccaaacggtaata
cctaattttataccaccatcacattcgaaatctaccatatgtttaatgaaaaatgaacaa
cctcaagccctatataatcatcaggtgataccaaacctaatccatagagctccattagat
actgaatcaaacaacacgcagaacgttccaatgggttttaaaaatccaataccacaaatg
tatgaaatcccgaaatacaatccatcagtaaactcaggacccaaactacctcttttgcca
cctacggccaatccccagcaaatagtacctaagcttgatttagactttacaacaggatta
gaaaacgtgaaaaattcatgctatatgaactgtgtaatccagtgcttattaagtacgcat
gacttaacaaagttatatttgacgaatgcattcttaactcaaattaatgttgagaataaa
ttgggatcgaaggggtttctctcgaaaaattttgcaaatttgattcaaacaatgtataag
aaaagtgcattccaaccttataatccgaattttctacatccagtagcacctttagagttc
aaaaatgcatgcggtatgatgaacagtatatatgctgagtcaacagaacaagattgtcaa
gaattttgtgaatttttattagatggattgcatgaagatttaaatcaatgtagtgggaat
ccaaggcccaaggaattaagcgcaaatgaagcagaattgagagaaagtttatcaatgaga
atagcctcagaaattgagtgggagtcatttctcacaactaattttagtcccataataaat
ctgtttcaaggacaatacgcttcaagattacaatgtcttatttgtcaacatacatcgacg
acgtaccaaccgttttccttgttatcaattccagtaccatcaatggttttctccaatggc
caaacttgcaacatattggattgtttcaaagaatttactaaatgtgaaaggttagataat
gatgagaaatggttttgtccgaaatgtcgaaggaaacaaatatcaaccaaacagttgaaa
attactagattacctaaaaatttgatcattcatttcaaacgattcgataattttatgaat
aagaataatatattcgtccaatacccatatcaattagatctaacatcgttatgggttaat
gattatgatgggaagttgccaccaaatttcaatgaaccgccgccgtcaagaggacaaaca
ccaccattcaaatataaattgaatgctgtctcatgccattccggaaacttggggagcggt
cattatactgcatatgttgataaaggtttatatcgtggttggtttcgatttgatgatgcg
tcgtatagaccagttaaatttggtacagagttcctcacgcctgatgcatatttattattt
tatcaacgtatttacgagtaa

DBGET integrated database retrieval system