KEGG   Naumovozyma dairenensis: NDAI_0C05950Help
Entry
NDAI_0C05950      CDS       T02234                                 

Gene name
NDAI0C05950
Definition
hypothetical protein
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.4.19.12]
Organism
ndi  Naumovozyma dairenensis
Brite
Enzymes [BR:ndi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     NDAI_0C05950 (NDAI0C05950)
Peptidases [BR:ndi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   NDAI_0C05950 (NDAI0C05950)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(1361343..1364585)
Genome map
AA seq 1080 aa AA seqDB search
MSDNKEESYSMYPPTNTSNNNNGPMPPPQGNMPFSVYQAPMQMYSYPQSPYIYGQAPSYS
FNMMNQNPMMYQNNSPNPNALGPQQHHHQHQQQQQHDMRMNKKKRNTNNNNNNMNGMMNP
TMNNMNSKHHNNSNNNNSNNNVNNPSSYYQNYNSMKKNYQPSNNGPISSSISSNNNNNTT
SNGAYDNYRFDMSKLSMKKTLEFPLFINTNQKDYAEARKKRREIQLKSFQATKQVRPIPE
KEEITKSIGTTTDSKNILTLKENENTLKEKKLETPAPFKVAVAEEKQEDTAEEQQTVELT
ETKSDEKNKQTLEPQPSIEIRKEKAQQQIKEDTITPPKQENIEVEIVSEPKTKSQNQTTI
DKPSTHKKEKHDKHDKQEKQTSKQLSSADTIKPSKEKSNVFKKEEKTEHKKKDKESRSKK
DDVTSPSPSSSTVPSISRTGTPEPIKSTTSLSTIPSTPKLWAAVASGGISKSKQVSNTTG
KSIASKTTIAINGETSSKNVHNDSNLRIPQRKDQKYIPSVTKGAESLGTIALRMCFDPDF
TNYALETTSNNNTKDHKVPIKSIVSRGIVNVANICFMSSILQMLLSCKPFIDVLNVTSTR
NLNSRVGPSSTKLLDACVALYSEFDKETFETEKNESSKITSSASSPSPVVPSSNDTRSSP
PSSSSFSSSSSSSSSSSDDTMLTAPAPEISSASSSSPTNIEKGLGSKTPSTTRLLSATIK
PSIVDAIKPDAFYKVLSTIPKFKDLQWGHQEDAEEFLTQLLDQLHEEIISAIECLTDNEI
ENLLQSITDEQLKIFIIRNLSRYNKAEFITKISPKLKELINKYGTMTDDTNDSGDSSNEW
HEVSGTSKKGKKNKTAVKRTVDVTPSPISNIFGGQFRSVLDIPFNKESQSITLDPFQTIQ
LDISDPMINDLETAFKKFSEFELLPFKSSSGKDVEAKKQTFIDKLPQVLLIQLKRFSFVS
NIGKDNGMTNYNSYNGRIEKIRKKINYNHELLVPVESVSSAILKNNESSRKYKLRAVVYH
HGSSPDGGHYTADIYNKDLKKWFMIDDVNITELEDADVVNGGDNGLDTRTAYILMYEKEI
NT seq 3243 nt NT seq  +upstreamnt  +downstreamnt
atgtctgataataaagaggaatcatactcgatgtacccacctacgaacaccagcaataat
aacaatggacctatgccacctccacaaggaaacatgccattctctgtatatcaagctcct
atgcaaatgtacagttacccacaaagcccttatatatatggtcaagctccaagctattcc
tttaatatgatgaaccaaaatccaatgatgtaccaaaataatagcccgaaccccaatgca
ttgggtccacagcaacatcatcatcaacaccaacagcaacaacaacatgatatgagaatg
aataagaagaaacgcaacacaaataataataacaacaacatgaatggtatgatgaatcca
actatgaacaacatgaactctaaacatcataataatagtaataataacaacagcaataac
aatgtaaataatcctagtagttattatcaaaactataatagcatgaagaaaaattaccaa
ccatctaataatggtccaatatcatcttctatttcttcaaacaataataataataccact
agtaacggtgcttatgataactatagattcgatatgtcaaaactatctatgaaaaaaaca
ttagaattcccattattcattaatactaaccaaaaggattatgcagaagcaagaaagaaa
agacgtgaaatacaattgaaatcttttcaagcaactaaacaagtgagaccaataccagaa
aaggaagaaataactaaaagtataggtactactactgattccaaaaatatattaacgtta
aaagaaaatgaaaataccctaaaggaaaagaaactcgaaactcctgcgcctttcaaagta
gcagtagcagaagaaaagcaagaagatacagcagaagaacagcaaacggttgaattaact
gaaaccaaatctgatgaaaaaaataaacaaacattggaacctcaaccttccattgaaata
aggaaagagaaagcgcaacaacaaatcaaagaagataccataacaccacccaagcaagaa
aatattgaagttgaaattgtaagtgaaccaaaaactaaatcacaaaatcaaacaacgata
gacaagccatccactcataagaaggaaaaacatgataagcacgataaacaggaaaagcaa
acatctaaacaactatcttcagcggatacaataaaaccttcgaaggaaaagtcaaatgtc
tttaaaaaggaagaaaaaactgaacataaaaagaaagataaagaatctcgttccaaaaag
gatgatgtaacttcaccttcaccttcatcatcaacagtaccttcaatatcacggaccgga
actccagaaccaataaaatcaacaacttctttatctactataccaagtacaccaaaatta
tgggcagctgtcgcgtcaggtggaatttcaaaatcaaaacaagttagtaatactactggg
aaatctatagctagcaaaaccactattgccatcaacggggaaacttcctcaaagaatgta
cacaatgactctaatttaagaattccccaaaggaaggaccaaaaatacatcccttctgta
actaaaggtgctgaatcattaggtaccattgcattaagaatgtgttttgatcctgatttt
actaactatgcattagaaacaacttcaaataacaatacgaaggatcataaagttccaatt
aaatcaattgtttccagggggattgttaatgtcgctaatatttgtttcatgagttctatt
ttgcaaatgttattaagttgtaaaccatttattgatgtattaaatgttaccagtacaaga
aacttaaattcaagagtaggtccatcatcaaccaaattattggacgcatgtgtagctctc
tattctgaatttgataaggaaacttttgaaacagaaaagaatgaatcatccaaaattaca
tcatctgcttcatctccatctcctgtagtaccatcatcaaatgatactagatcttcacca
ccttcttcttcctctttttcttcttcttcttcttcttcatcgtcttcatcagatgatacg
atgttgacggctccagcacctgaaatttcttctgcttcttcctcctcccctacgaatatt
gaaaaggggcttggttctaaaactccatctactacaaggctattatctgctactattaaa
cctagcattgttgatgcaattaaacccgatgccttctataaagttttatcaaccatacct
aaattcaaagatctacaatggggccatcaagaagatgctgaagaattccttactcaatta
ttagatcaattacatgaagaaatcatctccgcaattgaatgcctaacagataacgaaatt
gaaaatctattacaaagtataactgatgaacaattgaaaattttcataattagaaactta
tctcgttacaataaagctgaatttattactaaaatttctcccaaattgaaagaattaata
aacaaatacggtacaatgacagacgacaccaatgattcaggtgattcaagtaatgaatgg
catgaagtcagtggtaccagtaaaaaaggtaagaaaaacaagaccgcggtaaaacgtacc
gttgacgtgacaccatcaccaatctcaaacatatttggtggtcaattccgttcagtatta
gatatcccattcaataaagaatcacaatcaattacattagatccgttccagacgattcag
ttagatatttctgatccgatgattaatgatttggaaactgcattcaaaaaatttagtgaa
tttgaattattaccatttaaatcatccagtgggaaagatgttgaagctaaaaaacaaact
ttcatagataaattaccacaagtcttgttaattcaattgaaacgattctcttttgttagt
aatatcggtaaagataacggaatgactaattataatagttataatggtcgtatcgaaaaa
atacgcaagaaaattaattataaccacgaattgctcgttcctgtggaatctgtatcttct
gccattttgaaaaataatgaatccagtaggaaatataaattaagagctgtggtatatcat
catggtagtagtccagatggtggtcattacactgcagatatttataataaagatttaaag
aaatggtttatgatagatgatgttaatataacggaattggaagatgcagatgtagtaaat
ggaggtgataatggattagatacaagaacggcatatattttaatgtatgagaaggaaatc
taa

DBGET integrated database retrieval system