KEGG   Naumovozyma dairenensis: NDAI_0C06140Help
Entry
NDAI_0C06140      CDS       T02234                                 

Gene name
NDAI0C06140
Definition
(RefSeq) hypothetical protein
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
ndi  Naumovozyma dairenensis
Pathway
ndi00630  Glyoxylate and dicarboxylate metabolism
ndi01100  Metabolic pathways
ndi01110  Biosynthesis of secondary metabolites
ndi01200  Carbon metabolism
Module
ndi_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NDAI_0C06140 (NDAI0C06140)
Enzymes [BR:ndi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     NDAI_0C06140 (NDAI0C06140)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-GeneID: 11496445
NCBI-ProteinID: XP_003669516
UniProt: G0W912
Position
3:1420123..1421772
Genome map
AA seq 549 aa AA seqDB search
MLKDLISRETKFIEQWWRSPRFANIERPYTALDVFKHRGSIPRSQIKYPSSVQAKKLFKL
LENHFERKKPLHTLGVIDPVQMTQLSRSKEMKVVYLSGWACSSTLVSPSNDVSPDFGDYP
YTTVPNQVERIFKAQEFHDKKAFLKVVENESNAEDMVDYMKPIIADGDMGGSPHMVMKLS
KLFAEKGAAAIHLEDQLLGGKRCGHLSGAVLVPTGDHLSRLIACRFQWDLLGTENLLIAR
TDSCNAKLLSSSCDPRDHEFIKGISHRLNKQDSIGKDPRAWNEILVDAVSRKLDNDSMGQ
LEEQWYHDNELLTFDETVERLFSNEDFQRYLRTKSMMMEQELKRPYLSLKEMEMIANKIC
PTINIGFDWDAPRTKEGYYIFKGCMEAAIRRSLVFSPYSDMIWLETKTPDLKQAQMFSEE
IHSVYPHIKLVYNLSPSFNWSNHGYTPETLKTFIWDLAQEGFILQLVSLAGLHSDGLAFW
ELVKSFENNGMQGYVSTVQEREREIGSDVLTHQRWSGAEYIDSVMQVIQNGSSSQTLSTS
GDAFTETQF
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaagatcttattagtagagaaaccaaatttattgaacaatggtggaggtcacct
cgatttgccaatatagaaagaccatatactgcccttgatgtttttaaacatagaggatcc
ataccaagatcgcaaatcaaatatccatcttcagttcaagcaaagaaattattcaaacta
ctagaaaatcattttgaaagaaagaaaccgttgcatacgctaggtgttattgatcctgtt
caaatgactcaattgtcacgttctaaagaaatgaaagtggtttatttatcagggtgggca
tgttcttctactttagtgtcgccttctaatgatgtctcccctgattttggagattatcca
tatacaacagtaccaaaccaagtggaaagaatctttaaagcgcaagagttccacgataaa
aaggcctttttaaaagtcgtcgagaatgaaagtaacgcagaagatatggttgattacatg
aaacccattattgctgacggtgacatgggcggtagtccacatatggttatgaaattatcc
aaattgtttgctgaaaagggtgcagcagcgattcatttagaagatcaattactgggtggt
aaacgatgtggtcaccttagtggtgctgttttagttcccacaggtgaccatttatcaaga
ttaattgcttgtaggtttcagtgggatttattaggtactgaaaatctgcttattgcaaga
acggattcctgtaatgcaaaattactaagtagctcttgtgacccaagagatcatgaattc
attaaaggtatttcacatagattaaataaacaagatagcatagggaaggacccaagagcg
tggaacgaaattttggtggatgctgtatctcgtaaactagataatgattcaatgggccaa
ttagaggaacaatggtaccatgacaatgagttactaaccttcgatgaaaccgtagagaga
ttattttctaacgaagacttccaaagatatttaaggactaaaagtatgatgatggagcaa
gagttaaaaaggccatatttgagtttgaaagaaatggaaatgatcgctaataaaatatgt
cctacgattaatattggattcgattgggatgcaccaaggacaaaagagggttattatatt
ttcaaaggatgcatggaagctgccattagaagatcattagtcttcagtccatactctgat
atgatatggttagaaacgaagactcctgatttaaaacaagcccaaatgttttctgaagag
attcatagtgtttacccacatataaaattagtctacaatttatcacctagttttaattgg
tcaaatcatggatatacacctgagacattgaaaactttcatttgggacttagcgcaagaa
ggatttattttacagttagtttctttggctggattacactctgatggattggcattttgg
gaattggttaaatctttcgagaacaacgggatgcaaggttatgttagtacagttcaggaa
agggaaagagaaattggatctgatgttttgactcatcaacgttggtctggtgcagaatac
atcgattcggttatgcaggtgattcaaaatggttcttcttctcaaacattgagcacttct
ggtgatgcttttacagagactcaattttaa

DBGET integrated database retrieval system