KEGG   Naumovozyma dairenensis: NDAI_0D00480Help
Entry
NDAI_0D00480      CDS       T02234                                 

Gene name
NDAI0D00480
Definition
hypothetical protein
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
ndi  Naumovozyma dairenensis
Brite
Enzymes [BR:ndi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     NDAI_0D00480 (NDAI0D00480)
Peptidases [BR:ndi01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   NDAI_0D00480 (NDAI0D00480)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:complement(100433..101197)
Genome map
AA seq 254 aa AA seqDB search
MMVSHEDKERAVIPLESNPEVFTDFAKNLGLDPLFAFHDIYSLTDADLLAFLPRPVKAII
LLFPISDKQEKQDDVIKNDTQSVMSLSSKDAVWFKQTIKNACGLYAILHSLANNKSMLTS
DSILGQFINDNYETKNENNGNKNELTDDFIFDICNKFLKIFEAGETKAPDAHSDVDLHFI
TFVSNDKNQIFELDGRNPKGPSYLGDITASKNNADDTDLIGEKAIIDRVQWYMDNVEEGN
SLNFSLLGLSKSWD
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgatggtctctcatgaagataaggaaagggctgttatacctctagaatcgaatccagaa
gttttcactgattttgcaaaaaatttaggtttggaccctttatttgctttccatgatata
tattctttgacagatgctgatcttctagctttcttaccaagaccagttaaggcaattatc
ttattattcccaataagtgataaacaagagaagcaagatgatgttattaaaaatgatacc
cagagtgtaatgtcactttcttcaaaagacgctgtatggttcaaacaaacaatcaaaaat
gcttgtgggctttacgctatattacattctttagctaataataagtcaatgttaacctcg
gattctatcttgggccaattcataaatgataactatgaaacaaagaatgaaaacaatggc
aataaaaatgaattgacggatgatttcattttcgatatttgtaataagttcttgaaaatt
tttgaagctggtgaaacaaaggcaccggatgcacattctgatgttgacttacattttata
acgtttgtgtctaatgataagaatcaaatttttgaattggatggtagaaatcctaaagga
ccatcatatcttggtgatattactgctagcaagaataatgcggatgatacagatttaatt
ggtgaaaaagccattattgatagagtgcaatggtatatggacaacgttgaagagggaaat
agtttgaatttttctttattggggctatcgaaatcatgggattga

DBGET integrated database retrieval system