KEGG   Naumovozyma dairenensis: NDAI_0D00920Help
Entry
NDAI_0D00920      CDS       T02234                                 

Gene name
NDAI0D00920
Definition
hypothetical protein
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
ndi  Naumovozyma dairenensis
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    NDAI_0D00920 (NDAI0D00920)
Enzymes [BR:ndi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     NDAI_0D00920 (NDAI0D00920)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:211004..212974
Genome map
AA seq 656 aa AA seqDB search
MKLQLQDLLVLSVISLNQVEAWSPSNSYVPANVTCDDNINLIREANELSQSEIDWLEKRD
SYTRNALRSFLQRSTSNFSDNSLLDRLFQGSNSSNIPKIGVACSGGGYRAMLSGAGMLSA
MDNRTEGANEHGLGGLLQSTTYLAGLSGGNWLTGTLAWNNWTSVQDIINNMTVDDSIWDI
SDSIINSGGWNILSSAERWDHISDAVQAKQDAGFNISMADVWGRALSYNFFPSLYRGGVG
YTWSTIRDADVFKNGEMPFPISVADGRYPGTTVINLNATVFEFNPFEMGSWDPTLNSFTD
VKYLGTNVSNGKPINEGTCVAGFDNTGFIMGTSSTLFNQFLLQINNTSLPSFIRNLATHF
LKDLSEDYNDIAIYSPNPFKDAEFIGSNHSKSIVESKDLFLVDGGEDNQNIPLVPLLQEE
RNLDVIFALDNSADTNESWPDGASLVNTYQRQFGIQGESMTFPYVPDVETFINLGLNKKP
TFFGCDARNLTDLSYVPPLIVYIPNTRYSFNSNQSTFKMSYSTSERLNMIKNGFEATTRG
NFTDDEDFLGCVGCAIMRRKQQSLNETLPSECERCFTNYCWNGTRDSRPVSGINNSDFSS
SASIALAAEATSAASASGSSSTTQSSATKRNGAINMESSKSFMFIFTIFNIVLNML
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgcaattacaggatttgttggtcctttctgtaatttctttaaaccaagtggaa
gcatggtcaccatcaaatagttatgtccctgcaaatgtgacatgtgacgataacatcaat
ttgattagagaagctaatgaattatctcaatctgaaattgattggttggagaaaagggat
tcctatacaaggaatgcattgagatcattcttacaacgttccacttcaaatttttccgac
aattcattattagatagattatttcaggggtcaaattcgtcaaatattccaaaaattggt
gtggcatgttcaggtggtggttatcgtgccatgttaagtggtgctggtatgttgtctgct
atggataatagaactgaaggtgctaatgagcatggtcttggtggtcttttacaaagtact
acttatttagctggtctttcaggtgggaactggttaactggtactcttgcatggaataat
tggacttcagtacaagacattattaataatatgactgtggatgattccatttgggatatt
tcagattcaattattaattctggtggttggaatattttatcttccgcggagagatgggat
catatctctgatgcggttcaagccaaacaagatgctggatttaacatctctatggctgat
gtttggggtagagctttatcttataatttcttcccgtctctttatcgtggtggtgtaggt
tacacttggtccactataagagacgctgatgtctttaagaatggtgaaatgccattccca
atctctgttgcggatggtagatatccaggtactacagttattaatttaaatgctactgtt
ttcgaatttaatccatttgaaatgggttcatgggatccaactttaaacagtttcactgat
gtgaaatatttaggtaccaatgtatcaaatggtaaaccaatcaatgaaggtacatgtgtt
gctggattcgataacactggattcattatgggtacatcatcaactttatttaatcaattc
ttactacaaattaataatacaagtttaccatctttcattagaaatttagcaactcatttc
ttgaaagatttatctgaagattataatgatattgccatttattcaccaaatccatttaaa
gatgctgaatttattggttcaaaccattctaagagtattgttgaatccaaagatttattc
cttgttgacggtggtgaagataatcaaaatatcccattagtaccattattacaagaggaa
cgtaatctagacgtaatttttgcattagataattctgctgatacaaatgaatcatggcca
gatggtgcttccttagttaacacatatcaacgtcaatttggtattcaaggtgaaagtatg
acattcccatatgtcccagatgtggaaacttttattaatttaggtttaaataaaaaacca
acatttttcggttgtgatgcaagaaatttaactgatttgagttatgtcccacctttaatt
gtttatattccaaacacaagatattcattcaacagtaaccaaagtacatttaagatgtct
tattccacatctgaacgtcttaacatgattaagaatgggtttgaagctacaacaagaggt
aattttactgatgatgaagatttccttggttgcgttggttgtgccatcatgagacgtaaa
caacaaagtttgaatgaaacattaccatctgaatgtgaaagatgtttcactaattattgt
tggaatggtactcgtgatagtagaccagtgagtggtattaataatagtgacttttcatct
tctgcatcaattgccttggctgctgaagcaacaagtgctgcttctgcttctggttcctcg
tctaccactcaaagtagtgctacgaagaggaacggtgctataaacatggaaagttctaaa
tcattcatgtttattttcacaatcttcaacattgtattaaacatgctatga

  All links  
No link information was found.   
DBGET integrated database retrieval system