KEGG   Naumovozyma dairenensis: NDAI_0D01150Help
Entry
NDAI_0D01150      CDS       T02234                                 

Gene name
NDAI0D01150
Definition
hypothetical protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ndi  Naumovozyma dairenensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NDAI_0D01150 (NDAI0D01150)
Enzymes [BR:ndi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     NDAI_0D01150 (NDAI0D01150)
Exosome [BR:ndi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NDAI_0D01150 (NDAI0D01150)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:261356..263467
Genome map
AA seq 703 aa AA seqDB search
MMEIPENVKGAVEFDPYLKPYAQVLSERRYLADKWAYEITHATPDGSYQSLAKFSRDSYK
SYGLHANPQTKEISYKEWAPNAKRAFLVGEFNNWDGSNHELKNKDEFGNFYITIPPLSNG
DYAIPHDSKIKVKFQLEDGSEIYRLPAWITRATQPTKETAKQFGPTYEGRFWNPTEPYQF
QNNRPVFNESHDSLRIYEAHVGISSPEPKVTTYKEFTQNILPRIKKLGYDAIQLMAIMEH
AYYASFGYQVTNFFAPSSRYGTPEDLKELIDTAHGMGILVLLDVVHSHASKNVEDGLNNF
DGSDHQYFHSLSSGRGEHPLWDSRLFNYGNFEVQRFLLSNLTYYIDVYQFDGFRFDGVTS
MLYLHHGVGEGGAFSGDYNEYLSKERSGVDHEALAYLMLANDLVHELLPESAVTVAEDVS
GYPTLCLPRNIGGVGFDYRLAMALPDMWIKLLKEKSDDQWDMGHIVHTLTNRRYGEKVVA
YCESHDQALVGDKTLAFWLMDAEMYTGMTVLKEPSLVIDRGIALHKMIRLITHSLGGEAY
LNFEGNEFGHPEWLDFPNVNNNDSYHYARRQFNLVDDHLLRYQHLNNFDSTMQHTEMKYQ
WLNTPQAYVSLKHEVDKVIAFERNGKLFIFNFHPTNSFSDYRIGVEQAGSYRIILNTDRQ
EFGGQNRIDENARFFTTDLEWNNRKNFIQVYIPCRTAIILALE
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgatggaaatccctgaaaacgttaaaggtgctgtcgagtttgatccttatctaaaacca
tacgctcaagtcttaagtgaaagacgttatctagctgataaatgggcttatgaaattacc
catgctacccctgacggctcctaccaatctttagctaagttttcaagagattcttataaa
tcgtatggtctacatgctaatccacaaacaaaagagatctcttataaagaatgggctcca
aatgctaaacgtgccttcttagtaggtgaattcaataattgggatggatccaatcatgaa
ttgaaaaataaagatgaattcggtaatttttacattacaatccctcctttatctaatggt
gattacgcaatcccacatgattctaaaattaaagtcaaattccaattagaagatggttct
gaaatctatcgtttacctgcatggattacaagagccactcaaccaacaaaggaaactgca
aagcaatttggaccaacttatgaaggtagattctggaatccaactgaaccataccaattc
caaaataacagacccgtcttcaatgaatctcacgattctttaagaatttatgaagctcat
gttggtatctcatctccagaaccaaaagttactacttataaagaattcactcaaaatatt
ttaccaagaattaaaaaattaggttacgatgcaattcaattaatggctatcatggaacac
gcctattacgcttcattcggttatcaagtaacaaatttcttcgctccaagttctcgttat
ggtactccagaagatttaaaagaattaatcgatactgctcatggaatgggtatcttagta
ttattagatgtagttcatagtcacgcttccaaaaacgtggaagatggtcttaataacttc
gatggttctgatcatcaatattttcattcattgtcctctggtagaggtgaacatccttta
tgggattcaagacttttcaattacggaaattttgaagttcaaagattcttattatcaaat
ttaacttactatatcgatgtttatcaattcgatggatttagatttgacggtgttacttca
atgttatatttacatcatggtgttggtgaaggtggtgctttctccggtgattacaatgaa
tatttatcaaaggaacgttcaggcgtcgaccatgaagccttggcttacttaatgttggct
aatgatttagttcatgaattactacctgaatctgcagtcaccgtcgcagaagatgtctct
ggttatccaaccttatgtttaccacgtaacattggtggcgtcggtttcgattatagatta
gctatggctttaccagatatgtggattaaactcttaaaggaaaaaagtgatgatcaatgg
gatatgggccatatcgttcatactttgactaatagacgttacggtgaaaaagttgtggct
tattgtgaatctcatgatcaagctttagtgggtgataaaactctagccttttggttaatg
gatgctgaaatgtataccggtatgactgtgctaaaggaaccttctttagttatcgatcgt
ggtatcgcacttcataaaatgattagattaattactcattcattgggtggtgaagcatat
ttgaattttgaaggtaatgaattcgggcatccagaatggctagatttcccaaatgttaat
aataatgatagttatcattatgctcgtagacaatttaatttggtagatgatcacttatta
cgctatcaacatttgaataacttcgatagcactatgcaacatactgaaatgaaatatcaa
tggttgaatactccacaagcatacgtgtctttaaaacatgaagtagataaagttattgcc
tttgaacgtaatgggaaattattcattttcaatttccatccaacaaacagtttcagtgat
tatagaattggtgtcgaacaagctggatcttatcgtatcattttaaacactgacagacag
gaatttggtggtcaaaatagaattgatgaaaatgcaagatttttcacaactgacttagaa
tggaataatagaaagaatttcattcaagtttacattccatgcagaactgcaattatcttg
gctttagaataa

DBGET integrated database retrieval system