KEGG   Naumovozyma dairenensis: NDAI_0D01470Help
Entry
NDAI_0D01470      CDS       T02234                                 

Gene name
NDAI0D01470
Definition
hypothetical protein
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
ndi  Naumovozyma dairenensis
Brite
Protein kinases [BR:ndi01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   NDAI_0D01470 (NDAI0D01470)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:348789..356171
Genome map
AA seq 2460 aa AA seqDB search
MLTLKKRAESKRLARKKLASTSHSTDDISTTSGQVSIPSNPNNSRRVLLVPGSDTTRLNE
GDFTTADLDSAFSTFDPIFEQLKSPISQERINAAAELNISLISLVRELSVEDFQRFSNIL
NNKIFELVHGTDSNEKIGGILAVDTLINLYLHTEELPNQTSRLANYLRVLIPSNDIEVMR
LAANTLGKLAVPGGTLTSDFVDFEVKTCLEWLTSTPETISSSSKQEYRKHAALLLITALA
DNSPYLLYPYINPILENIWRALRDIKLVIRMDAAVTLRKCLSIIRERDPSLTKDWFQKLF
KGCQRGLTLNTNESIHATLLVYRELLSLRDSFLNGKLNEIYLSTIKYKDHKFEVIRKEVY
AILPLLSSFDTKLFIKSYLDPIMLHYLMVLKSTTSSSTVNSDKAAILVSIGDIAFQVKSH
ITRYIDPILDTIRDGLKSKFKHRKLFEKELFYCIGKLACAVGPALAKNLNRDLLDLMLNC
LLSDYMQETFIILNKEIPALEATINSRLLDYISASLSGQKYDVAGTLTPLEPLDMERSRR
WRNKIIHDKTGEINDDIRDAQYLTQALKMLRSINYKKSLTEFARQIIIFYIEHEDSDVRK
LAALITCELFTKDPICKQISRNALQSVSEVLSKLLTVSITDPVSEIRLEVLRHLTSAFDS
HLAQPDNSRLLFMAVNDEIFTIQIEAIKIVARLSSVNPAYFMPSLRKTLLELLTQLRYSN
MPRKKEEYATLLYTMIQSGSEITKPYIEPVLDVLLPRCQDPSSSVASTSLKALGELSVVA
GEDIKKHLNVLMPLIINTFQDHSSFKRNAALKTLSQLATSSSYVIEPLLDYPELLGILIN
ILRGDGPQDVKRETIKLIGILGALDPYKVRAIEGRASLESQIEQNTPSIDIALLMKGMSP
SDDEYYPTVVVNTLLKILYDPTLSSHHTAVIQAILNIYQSLGVRCVSFLDKVVPGLLSVM
RTCTPSLLEFYFQQLSMLISIVRQHVRPYVDEIFSVIQMFFPIIKLQITIISTIEAISKA
LESEFKKYVPLVLTSYLAILENDKSNKKAVSIRILKSLIVLGPYLEDFSHLIIPSVVRMS
EYSPGMLGKIAVIALGKLAKNINLCEMSSRIVQTLIRLLNRGEPDLIKTSMNTLCLLLLQ
QGTDFVVFIPILNKVLINNHIQHSIYDQLVNKLLNNESLPTNIIFDKEFDVSSKELKEND
SGYKKLPLNQEALKNTWEASQQRTKEDWQEWLRRLSIQLIRESPSPALRACANLVSVYYP
LARELFNASFSSCWSDLYSPYRDDLIKALCVALSSPQNPPEIYQTLLNLVEFMEHDDKPL
PIPFETLGQYAQKCHAFAKALHYKEVEFLQEPTAPTIEALISINNELHQNDAAIGILKLA
QQHHDLQLKEIWYEKLQRWEDALTAYNEREVAGEGSIEVTMGKMRALHALGEWEQLGSLT
EEKWAISKPNVQKLMAPLAAGAAWGLGQWDKLEEYSTVMNVHSSDKEFFDAILCIHRNNL
DEGQHHILNARDLLLTELSTLINESYNRAYGVLVRAQIVSELEEIISYKKLPYNSSKRGL
MRKTWNKRLLGCQKNVDIWQRVLRIRSLVIKPKQDADLWIKFANLCRKSGRMGLAKKALT
SLLEEDGEPHRFNTVRASPLVVYSQLKYLWAIGSQEKALKYLMNFTSRVACDLGLDPSNM
ISEHYPQNDRIAPEATEEYMKLLARCFLKQGEWRVALEPNWRLKNPDEVLGSYLLATHFD
NSWYKAWHNWALANFEVISVITSGGGTNITDKDISLGNINLQKSGMIGANTFDTEGGNYP
LTMINRHVIPAIRGFFHSISLSDSSSLQDALRLLTLWFTFGGIPEANQAMHEGFTLIKIA
TWLEVLPQLISRIHQPNQFVSRSLLSLLSELGKAYPQALVYPLTVAIKSESVSRQRAALS
IIEKMRMHSPVLVAQAELVSSELIRVAVLWHELWYEGLENASRHYFGENDISKMLSSLEP
LHDLLQNGAETLREISFQNAFGRDLNNAYEWVNNYKQTKDKTNLNQAWDIYYNVFRKISK
QLPSLQTLELPHVSPKLFNAHDLELAVPGTNILTKEIVKISSFEPVFSVISSKQRPRKVN
ILGSDGKQYQYVLKGHEDIRQDSLVMQLFGLVNTLLKNDDECFRRHLNIQQYPAIPLSPK
SGILGWVQNSDTFHVLIKEYREARKIPLNLEHWVILQMAPDFDNLTLLEKVEVFTHALEN
TQGQDLYKVLWFKSRSSESWLERRTIYTRSLAVMSMAGYILGLGDRHPSNLMLNRITGKV
VHIDFGDCFEAAILREKFPEKVPFRLTRMLRKAMEVSGIEGTFRITCENVMRVLRDNKES
LMAILEAFAFDPLIHWGFDLSTEKIIEQTGIDLPSTNPNDLLRENRVTVEEAAKMEIEQK
NAIRNARALLVLKRITNKLTGNDIGNNHELAVPEQVEQLIQQAISVENLCQHYIGWCPFW
NT seq 7383 nt NT seq  +upstreamnt  +downstreamnt
atgcttacgctgaagaagagagctgaaagtaaaaggctggcgagaaagaagctggcttct
acctcacattcgacagacgacatatccacaacttccggccaagtatccataccaagtaat
ccaaacaatagtagaagagtcttattggttcccggatcagatacaactcgattaaatgaa
ggggattttacaactgcagatttagactctgcattttctacgtttgacccaatatttgag
cagttaaaaagccccatctcacaagaaaggataaatgcggcagctgaattgaatatatct
ctgatctctctcgtcagagaactctctgtagaagacttccaacgttttagtaatatttta
aacaataaaatatttgaattagttcacggcacagactcaaatgagaaaatcggtggtata
ttagcggtagatacacttatcaacctgtatctacatacagaagaattaccaaaccaaacc
tcaagactagctaactacctgcgtgttttaattccatccaatgacatagaagtgatgaga
ttagcggccaacacgctggggaagctcgctgtacctggtggaacattaacgtctgatttt
gtggattttgaggtaaaaacgtgtttggaatggctgacttccacacctgagactatatcg
tcaagttctaagcaagaatataggaaacatgccgctttacttctaataaccgctttagca
gacaattctccatacttattatacccatatattaatcctatcctcgaaaatatatggcga
gcgttgagggatattaagttagttattagaatggatgccgctgtaactttaagaaagtgt
ctatcaataatacgggaaagagacccttcattaaccaaggattggttccaaaaattattc
aaaggttgccagagaggacttaccttgaatacaaacgaatcaatacatgccacgttgctc
gtttatagagaattactatccttaagagattcgttcttaaatggaaaactgaacgaaata
tatctatccactataaagtataaagatcacaagtttgaggtaattcgaaaagaagtatat
gcaattttaccgttgttatcatcatttgataccaaattgtttatcaaatcgtacctcgat
ccaattatgcttcactatttaatggttttgaaaagtacaacgagtagctcaacagtaaac
tctgataaagctgctatactagtttctattggagatattgcgtttcaagttaaatcacat
ataacgcgttatattgatcccattctagacacaatacgagatggcttgaaaagtaaattt
aaacataggaagttgtttgaaaaagagctgttttattgtataggaaagttagcgtgtgca
gtcggcccggcccttgcgaagaacttgaacagagacttattggatctgatgcttaactgt
ctgctttcagattatatgcaagaaacgtttatcattttaaacaaagagatacctgcactt
gaagctacaatcaattcacgacttttagattatatatccgcatcactttcggggcaaaaa
tatgatgtagctggaacgcttaccccactggaaccattggatatggaaaggtctcgtcgt
tggagaaataaaataatacatgacaaaaccggtgaaataaatgacgatataagagatgcc
caatatttaacgcaagcgttgaaaatgctgcgttcgattaactataagaaatccttgaca
gaatttgcgagacagatcataatattctatattgaacatgaagatagtgatgtcagaaaa
cttgcagcgttgataacctgcgagttatttacaaaagatccaatttgtaaacaaatatcg
agaaatgctttgcaatctgtgtctgaagtcctaagcaaattattgacggtttcaattact
gatcccgtatctgaaataaggttggaagttttgcgacatctcacctctgcattcgattcc
catcttgctcaacctgacaatagtcgcttactttttatggccgtaaatgatgaaatcttt
actatccaaatagaggcaattaagattgtcgctcgattgagttccgttaatccggcatat
ttcatgccatctttacgaaaaacattactcgaattattaacacaattacgatactctaat
atgccaagaaagaaagaagagtatgcgacgctattatataccatgatccagtccggtagt
gagattacaaaaccatatatagaaccagttttggacgttctattaccaagatgccaagac
ccttcttctagtgtagcttcaacttcgctgaaagccctaggggagctttccgtggttgct
ggagaagacataaaaaaacatcttaatgttctcatgccgctaatcataaatacctttcaa
gatcattcaagtttcaagagaaatgctgcattaaaaacacttagtcaattagcaacttct
tctagctacgtaatagagcctttattggactatccagagctgttgggtattctgattaat
attttaaggggagatggtccacaagatgtgaagagagaaacaatcaagttaattggtatt
ttaggtgctcttgatccatataaagtgagggcaattgaaggacgtgcaagtttagaaagt
caaatcgaacaaaacactccttcaatcgatattgcacttctcatgaaaggaatgtctccc
tccgacgacgaatactatcccacagttgttgtaaatacccttttgaaaattttatatgac
ccaacactttcttctcatcacacagctgtaatacaagcaatcttaaatatttatcaaagt
ctgggggttcgatgtgtatcttttttggacaaggttgtcccgggattactgtcagtaatg
agaacgtgcaccccgtccttattggaattttatttccagcaactaagtatgctcatttca
attgtaaggcagcacgttagaccctacgtagatgagattttcagtgttatccagatgttc
ttccctatcattaaactacaaatcactattatttctactatagaagccatttcaaaagca
cttgaaagtgaattcaaaaaatacgttcccctcgtactaacgtcctatcttgctatcctt
gagaatgacaagtcgaataaaaaggcggtctcaatccgaattttaaagtcccttatcgtc
ttaggaccatacttggaagacttttctcatcttatcataccttcagtggtaaggatgtcc
gaatattcacctggcatgctaggaaaaattgcagttattgcattgggaaaacttgcaaaa
aatataaacctttgtgaaatgtcgtcaagaatcgttcaaacgttgatacgattgctaaac
aggggtgaacctgaccttattaagacatcaatgaatactctatgcttacttttgctacag
caaggcacagattttgttgtctttatcccaattttgaacaaagtcctcataaataaccac
atacaacattcaatttacgatcagttagtcaataaactattgaataatgaaagtttacct
actaatattatctttgacaaagaattcgatgtctcctcaaaggagcttaaggaaaatgac
tctggttataagaaattaccactcaatcaagaagcgttgaaaaatacctgggaagctagt
cagcaaaggaccaaggaggactggcaagaatggctgcggagattatccatccaattgata
cgagaatcgccttcacctgcactcagggcatgtgctaatctggtaagtgtctattaccct
ctggctcgtgagctattcaacgcatcattttctagttgttggagtgacttgtatagcccg
tatcgagatgatcttattaaggcactatgcgtggcattatcatccccgcaaaaccctccg
gaaatataccaaacattattgaatttagttgaattcatggaacatgacgacaaaccgtta
ccgataccatttgagacattaggacaatatgcccagaaatgccacgcctttgcgaaagca
ctgcattataaagaagtagaatttctgcaagaaccaacagcgccgactatagaagcttta
ataagcataaataacgaactccaccaaaatgatgcggccatcggtattttaaagttagca
caacaacaccatgatttacaattaaaggaaatatggtatgaaaaattgcaacgttgggaa
gatgcgctaaccgcatataacgaacgtgaagttgcaggtgaaggaagtatcgaagttact
atgggtaaaatgagagcgctgcatgcgttaggcgaatgggaacaattaggtagtttaaca
gaggaaaaatgggcgatctcgaaacccaatgtccagaaattaatggcaccattagcagct
ggggctgcttggggcttgggccagtgggataaattagaagaatatagtacagttatgaat
gtccattcttctgataaagaattttttgatgccatcttatgtatccatcggaacaatctc
gatgagggccaacaccatatacttaacgcgagagatctgcttttaacagaattatcaaca
ctaatcaatgaaagctacaacagagcttacggtgtcctcgtaagggcccaaattgtatca
gaattggaagaaatcattagttacaaaaaattaccgtataattcgagtaaaagaggctta
atgagaaaaacttggaataaaagattacttggctgccaaaaaaacgtagatatttggcag
agagttttaagaattcgctctttagtcataaagcccaagcaagatgccgacctttggatt
aagttcgcgaatttatgtaggaaatcgggtagaatgggactggctaaaaaagcattaact
tcccttttagaagaagacggtgagccacatcgtttcaatactgttagagcaagtccactg
gtagtttattcacagttaaagtacttatgggcaatcggttctcaagaaaaagccttaaaa
tatctgatgaatttcacatctcgagtggcatgtgatttaggcctcgacccgagtaatatg
atttctgaacattatccacagaacgatagaattgcaccagaagccactgaagagtacatg
aaattattagcacgttgctttctaaaacagggtgaatggcgtgtcgcattagagccaaac
tggcggctcaaaaacccagatgaagtcctggggtcgtacttattggccactcatttcgat
aacagctggtataaggcgtggcataattgggcattggcaaattttgaagttatctcggtc
attacatctggtggggggacgaatattaccgataaagatatctctttaggaaacataaat
ctccagaaaagtggtatgatcggtgcaaacacattcgatacggaaggaggtaattatcca
ctaaccatgatcaatagacatgtaattccagcaattcgtgggttcttccattccatttct
ctctccgattctagttctttacaagatgctttaagattattgacattatggtttacgttt
ggtggtatcccagaagcaaaccaagctatgcacgaaggttttacattgattaagatcgct
acatggcttgaagtgttgccgcaactaatttctagaattcatcaacccaatcagtttgtg
agcagatcgctattgtcgttgttatctgagttaggtaaggcctacccgcaagcactcgtt
tacccgttgacggtggcgattaagtcagaatctgtgtcgagacaaagggcagcattatca
attatcgagaaaatgagaatgcatagtcccgttttagtcgctcaagctgaactagtcagt
agtgagcttattcgtgttgctgttctttggcatgaattatggtatgaagggttagaaaat
gccagccgacactattttggagaaaatgatatatcaaagatgctatcttctttggaacca
ttacatgatttattgcagaatggcgcagaaactcttcgtgagatctcatttcagaacgcc
tttggtagagatcttaacaatgcctatgaatgggttaataattataaacaaactaaggat
aaaactaatctgaaccaagcgtgggatatatattataatgttttccgaaagattagcaag
caactaccatcgttacaaactttagagttgccacacgtatctcctaagcttttcaatgca
catgatttagaattagctgttccaggtaccaatattttaactaaagaaatagttaagata
tcgtcatttgaaccggtattttctgtaatttcatcgaagcaaaggccccgtaaagttaat
atattaggaagtgatggaaaacaatatcaatatgtactaaaagggcatgaagatattagg
caagatagtttagtgatgcaacttttcggattagtaaataccttactgaaaaacgatgat
gaatgtttccgccgtcacttgaacatacagcagtaccctgctatcccattatcacctaaa
tctggtattctaggttgggttcaaaatagtgatacattccatgttttaattaaggaatat
cgtgaagcaaggaaaatccctttaaaccttgaacattgggtaattctgcaaatggcacca
gattttgacaatttgaccttattagaaaaggtcgaagtctttacgcatgccttagaaaat
acacaaggtcaagatttgtacaaagtcttatggttcaagagtaggtcctcagaatcctgg
ttggagcgtcgaactatatataccagatcacttgcagtaatgtccatggctggatatata
cttggtttaggagatcgtcatccaagtaatttaatgctaaacagaataacaggaaaagta
gttcatattgacttcggtgattgttttgaagctgcaatattacgtgagaaatttccagaa
aaggtaccatttaggttgacaagaatgcttagaaaagcaatggaagtaagtggaattgaa
ggcactttccggatcacatgtgaaaatgttatgagagttttaagggataataaggaatca
cttatggcaatattggaagcttttgcgttcgatcctttaatccattggggctttgattta
tcgacagaaaagattattgaacagactggaatcgatcttccaagtacaaatccaaatgac
ttactaagagaaaatagggtaactgttgaagaggcagctaagatggagatcgaacagaaa
aatgctataaggaacgctagagccctcctagtattgaaacgtattacaaacaagttgaca
ggtaatgatatcggaaataatcatgaacttgctgtaccggaacaggtagaacaattgatc
cagcaagccatctcagtcgagaacctgtgccaacattacattggttggtgtccgttttgg
tga

DBGET integrated database retrieval system