KEGG   Naumovozyma dairenensis: NDAI_0D01620Help
Entry
NDAI_0D01620      CDS       T02234                                 

Gene name
NDAI0D01620
Definition
hypothetical protein
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
ndi  Naumovozyma dairenensis
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    NDAI_0D01620 (NDAI0D01620)
Enzymes [BR:ndi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     NDAI_0D01620 (NDAI0D01620)
Protein kinases [BR:ndi01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   NDAI_0D01620 (NDAI0D01620)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:386654..388132
Genome map
AA seq 492 aa AA seqDB search
MAEKIDRHSFKVFNQDFTVDKRFQLIKEIGHGAYGVVCSARFAEAVEETTVAIKKVTNVF
SKTLLCKRSLRELKLLRHFRGHKNITCLYDMDIVFYPDGSFNGLYLYEELMECDMHQIIK
SSQPLTDAHYQSFIYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKICDFGLARGFSE
NPVENNQFLTEYVATRWYRAPEIMLSYQGYTKAIDIWSTGCILAEFLGGKPIFKGKDYVD
QLNRILEVLGTPPDETLRRIGSKNVQDYIHNLGYIPKVPFVNLYPNANLQALDLLEKMLA
FDPQRRITVDEALEHPYLSVWHDPSDEPVCSEKFEFSFEVVNDMEELKQMVIDEVHDFRK
FVRKPLLEEEEQAKHQAQLQAQQQAQVQMQQQQQAEQQAQQQIQGSINGSNYSQQMGFQS
PIQSQMNDNVVGIDSQGLPRHDTDFPPPPQENLLESPANFNIGGTNGNEQDAGDAFLDLE
KELEFGLDRKYL
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaaagatcgatcgacactcattcaaggtattcaaccaagactttacagtggat
aaacgtttccagttgataaaagaaattggtcacggagcatatggtgtagtatgttcagca
aggtttgcagaagctgtcgaagaaacgactgtagccattaaaaaagtaactaatgtcttt
tcaaagactttattatgtaagagatcattacgtgaattgaaactgttaagacattttaga
ggacataaaaatattacttgtctttatgatatggatattgtattttatcccgatggatca
ttcaacgggttatatttatatgaagaattaatggagtgtgatatgcaccaaattatcaaa
tccagtcaacctttaactgacgcgcattatcaaagttttatttaccaaatactttgtgga
ttaaaatatattcattcagcagacgtattacatcgtgatttgaaaccaggtaatctatta
gtaaatgctgattgtcagttaaaaatatgtgattttggtttagcaagagggttttcagaa
aatccagtagaaaataatcaattcctaactgaatatgtggctacaagatggtaccgtgct
ccagagattatgttaagttatcaaggttatacaaaagctattgatatttggtctacaggt
tgtattcttgctgagtttcttggtggtaaacctattttcaaaggtaaggattatgttgat
caattaaatcgaatattagaggttcttgggactccacctgatgagactttaagaagaatt
ggttcgaaaaatgtgcaagattatatccataatttaggttacattcccaaagtcccattt
gttaacctctatccaaatgcgaaccttcaagcacttgatttattagaaaaaatgctagcg
tttgatccacagagaagaataacggttgatgaagcattagaacatccctatttgtcagta
tggcatgatccatcggatgaacctgtatgtagtgagaagtttgaatttagctttgaagtt
gtcaatgatatggaagaattgaaacaaatggtcattgatgaagtacatgatttcagaaaa
tttgtgaggaaacctttgttggaagaggaagaacaagcaaagcatcaagctcaattacaa
gcgcagcaacaggcacaagttcaaatgcaacagcaacaacaagctgaacaacaagcccaa
cagcagatacaagggtcaataaatgggtctaattactcacaacaaatggggttccaatct
ccaatacaatctcaaatgaatgataacgttgttggaattgattcacaaggtttaccacgg
cacgatacagacttcccacctcctccacaagagaacctcttggaatcgccggcgaatttc
aatattggtggtaccaatggcaacgaacaggatgcaggggacgcatttttagatcttgag
aaagaattggaatttggattggataggaagtacttataa

DBGET integrated database retrieval system