KEGG   Naumovozyma dairenensis: NDAI_0D01620Help
Entry
NDAI_0D01620      CDS       T02234                                 

Gene name
NDAI0D01620
Definition
(RefSeq) hypothetical protein
Organism
ndi  Naumovozyma dairenensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:386654..388132
Genome map
AA seq 492 aa AA seqDB search
MAEKIDRHSFKVFNQDFTVDKRFQLIKEIGHGAYGVVCSARFAEAVEETTVAIKKVTNVF
SKTLLCKRSLRELKLLRHFRGHKNITCLYDMDIVFYPDGSFNGLYLYEELMECDMHQIIK
SSQPLTDAHYQSFIYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKICDFGLARGFSE
NPVENNQFLTEYVATRWYRAPEIMLSYQGYTKAIDIWSTGCILAEFLGGKPIFKGKDYVD
QLNRILEVLGTPPDETLRRIGSKNVQDYIHNLGYIPKVPFVNLYPNANLQALDLLEKMLA
FDPQRRITVDEALEHPYLSVWHDPSDEPVCSEKFEFSFEVVNDMEELKQMVIDEVHDFRK
FVRKPLLEEEEQAKHQAQLQAQQQAQVQMQQQQQAEQQAQQQIQGSINGSNYSQQMGFQS
PIQSQMNDNVVGIDSQGLPRHDTDFPPPPQENLLESPANFNIGGTNGNEQDAGDAFLDLE
KELEFGLDRKYL
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaaagatcgatcgacactcattcaaggtattcaaccaagactttacagtggat
aaacgtttccagttgataaaagaaattggtcacggagcatatggtgtagtatgttcagca
aggtttgcagaagctgtcgaagaaacgactgtagccattaaaaaagtaactaatgtcttt
tcaaagactttattatgtaagagatcattacgtgaattgaaactgttaagacattttaga
ggacataaaaatattacttgtctttatgatatggatattgtattttatcccgatggatca
ttcaacgggttatatttatatgaagaattaatggagtgtgatatgcaccaaattatcaaa
tccagtcaacctttaactgacgcgcattatcaaagttttatttaccaaatactttgtgga
ttaaaatatattcattcagcagacgtattacatcgtgatttgaaaccaggtaatctatta
gtaaatgctgattgtcagttaaaaatatgtgattttggtttagcaagagggttttcagaa
aatccagtagaaaataatcaattcctaactgaatatgtggctacaagatggtaccgtgct
ccagagattatgttaagttatcaaggttatacaaaagctattgatatttggtctacaggt
tgtattcttgctgagtttcttggtggtaaacctattttcaaaggtaaggattatgttgat
caattaaatcgaatattagaggttcttgggactccacctgatgagactttaagaagaatt
ggttcgaaaaatgtgcaagattatatccataatttaggttacattcccaaagtcccattt
gttaacctctatccaaatgcgaaccttcaagcacttgatttattagaaaaaatgctagcg
tttgatccacagagaagaataacggttgatgaagcattagaacatccctatttgtcagta
tggcatgatccatcggatgaacctgtatgtagtgagaagtttgaatttagctttgaagtt
gtcaatgatatggaagaattgaaacaaatggtcattgatgaagtacatgatttcagaaaa
tttgtgaggaaacctttgttggaagaggaagaacaagcaaagcatcaagctcaattacaa
gcgcagcaacaggcacaagttcaaatgcaacagcaacaacaagctgaacaacaagcccaa
cagcagatacaagggtcaataaatgggtctaattactcacaacaaatggggttccaatct
ccaatacaatctcaaatgaatgataacgttgttggaattgattcacaaggtttaccacgg
cacgatacagacttcccacctcctccacaagagaacctcttggaatcgccggcgaatttc
aatattggtggtaccaatggcaacgaacaggatgcaggggacgcatttttagatcttgag
aaagaattggaatttggattggataggaagtacttataa

DBGET integrated database retrieval system