KEGG   Naumovozyma dairenensis: NDAI_0D02240Help
Entry
NDAI_0D02240      CDS       T02234                                 

Gene name
NDAI0D02240
Definition
hypothetical protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
ndi  Naumovozyma dairenensis
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    NDAI_0D02240 (NDAI0D02240)
Enzymes [BR:ndi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     NDAI_0D02240 (NDAI0D02240)
Glycosyltransferases [BR:ndi01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   NDAI_0D02240 (NDAI0D02240)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:524453..526699
Genome map
AA seq 748 aa AA seqDB search
MSASTGIESHSIENKLRKRASNEDAVITNNIDIGKHSNETYVKTKMYMGKRFDLRGITSI
ASPALFTILSFYLRFKNIDKNNHVVWDEAHFGKFGSYYITHEFYHDVHPPLGKMLVALSE
YLAGFDGHFSFDSNTKYPSEMNFKFMRQFNATFGALCVPLTFFTAKNLGFSWQTTYLVTL
MVTLEHSYITLSKFILLDSILLFFTLTTFACLVKIYTLRKKQLTRKWSLWMLLTGISVGC
VCSVKWVGLFITIVVGIYTLMDLFSLHHDENLSRVKYYKHWLIRIIDLIIIPFLIYMFCF
KIHFALLYKSGTGDASTNTLFQINLENTKIEIGPRNVAFGSEVTIRSHGLSPNLLHSHVQ
LYPDGSKQRQVTGYAHSDANNNWEFHFADHNYSPNDTIIRDVMDGMDIRLVHKNTRNNLH
SHKIPSHVSRGNFEVSGYGNDDDFVDSNDIWTIELVDQLDSSNPNYPKEDPTILHPVSTF
FRLRHKKLGCYLASTGLTYPQWGFQQAEIVCKNSWSKRDKATWWNVEDHWNSRLTVAEEY
LPPKSKFWTDFVLINFAMASSNSALIPDQDKFDPLASEPWEWPTLHKGLRMCSWSRDSYR
YYLMGSPFNTWISTLSLFGFVLLMLRIIFKWGRQTINLTEDQIWKLLITGVFPFFSWIMH
FLPFVMMGRVTYVHHYVPALYFAILVFGFVIEQLFVSAHPIIKYPAFIILATGCIWVYII
FAPICQGLHGPLTQYLRLQWLPSWDIII
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcttcaacaggaattgaatcacatagtattgaaaataaactcaggaagagagca
agcaatgaagatgctgttataacgaataatatcgacattggaaaacattccaatgagaca
tatgttaagaccaaaatgtatatgggaaaaaggtttgatctacgaggaataacatcaatt
gcaagccctgctctcttcacgattctctcattctaccttcgtttcaaaaatattgacaaa
aataatcacgtagtgtgggacgaagctcattttggtaaattcggttcctattatataaca
catgaattctatcatgatgtccacccgccattgggtaaaatgttagtcgcattgagtgaa
tatctcgccggctttgatggtcatttcagctttgattcaaatacaaaatatccatcagaa
atgaattttaaattcatgagacaattcaatgcaacttttggtgcgttatgtgtcccctta
acgttctttactgccaaaaatttggggtttagttggcaaactacttatttagttacatta
atggtcactttggaacattcatatattacattgtccaaatttatattattagattcaatt
ctattgtttttcactttgactacatttgcatgtttagtgaagatttacactttgagaaag
aagcaattgacaagaaaatggtcactatggatgttattgacagggatttctgtggggtgc
gtatgctctgtgaaatgggttggtctgtttattacaattgtcgtcggtatctatacacta
atggatttattttcattacaccacgatgagaatctatcaagggtaaaatactataagcat
tggttaatcagaattatagatttaataatcataccattcctaatttatatgttttgcttt
aagatccattttgccttactttataaatcagggacaggagatgcatcaacgaacacttta
tttcaaattaatttagaaaatacaaagattgagattggtccacggaatgtcgcgttcggt
tccgaagtaactatccgatctcatggtctcagtcctaatttattacattctcatgtccaa
ctttatccagacggttcaaaacaacgtcaagtaacaggttatgctcattcagatgcgaat
aacaattgggaattccatttcgcagaccataattattcaccaaatgatactatcatccgc
gatgttatggacggtatggatattagattagtgcataagaatacacgtaataatttacat
tctcataaaattccatcacacgtttcccgtggtaatttcgaagtttcagggtatggcaat
gatgatgattttgtagatagtaatgatatttggaccattgaattggtggatcaattagat
tcgtctaatcctaactatcctaaagaagaccctactatattacacccagtatcaacattt
ttcaggttgagacataagaaattaggttgttatcttgcatctactggattaacttatcct
caatgggggttccaacaggcagaaattgtctgcaaaaattcgtggagcaaaagggacaaa
gcaacttggtggaatgtagaggatcattggaatagtcgtttaactgtcgctgaagagtat
ttgccaccgaaatctaagttttggacagattttgtccttataaatttcgcaatggcctca
tctaatagtgcattgatcccagaccaggataagtttgaccccctagcttcagaaccatgg
gaatggcctactttacataaaggtttaagaatgtgtagttggtctcgcgattcttataga
tattacctaatgggatcaccgttcaatacttggatctccaccttatcattatttggcttc
gtgttactgatgctaagaattatcttcaaatgggggagacaaacaatcaatttaactgaa
gatcaaatttggaagttattgataactggggtcttcccatttttttcctggataatgcat
ttcttaccgtttgttatgatgggaagagttacgtatgttcaccactacgttcctgcatta
tatttcgcgatcttagtgtttgggtttgtaatcgaacaactcttcgtttctgctcatcct
attatcaagtatccagcatttataatattggcgacaggctgcatatgggtatacataata
tttgctccaatttgtcaggggctacatggtccattaactcaataccttcgtttacaatgg
ttaccatcgtgggatattataatttaa

DBGET integrated database retrieval system