KEGG   Naumovozyma dairenensis: NDAI_0D02480Help
Entry
NDAI_0D02480      CDS       T02234                                 

Gene name
NDAI0D02480
Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ndi  Naumovozyma dairenensis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    NDAI_0D02480 (NDAI0D02480)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    NDAI_0D02480 (NDAI0D02480)
Enzymes [BR:ndi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     NDAI_0D02480 (NDAI0D02480)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:complement(574299..574784)
Genome map
AA seq 161 aa AA seqDB search
MSEFYKLTPKDKKGEDYPFTQLEGKVVLIVNVASKCGFTPQYKELESLYKKYQDKGLVIL
GFPCNQFGHQEPGTDEQIGQFCQLNYGVTFPILKKINVNGNDMDPVYEFLKSKKSGLLGF
KGIKWNFEKFLIDRKGEVVQRYASLTKPSSIEQDIERLLNK
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaattttacaaactaactccaaaggataaaaagggtgaggattatccctttaca
caactagaaggcaaagtagtcttgatcgtgaatgtcgcttccaaatgtgggttcactcct
cagtacaaagaattagaatctctatataagaaatatcaagataaaggtttagttatcttg
ggtttcccatgtaatcaattcggtcatcaagaaccaggtacagatgagcaaattggacaa
ttctgtcaattgaattatggtgttactttccccattttgaaaaaaattaacgttaatggg
aatgatatggatccagtttatgagtttttgaaatctaaaaaatcaggattgttgggattt
aaagggatcaaatggaattttgaaaaattcttaatcgatagaaagggggaagttgtccaa
agatatgcttctcttacaaaaccttcttctattgaacaagatatcgaaagattgttgaat
aaataa

DBGET integrated database retrieval system